(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE468

PENCW_13.PE468       Location/Qualifiers
FT   CDS_pept        join(complement(1080026..1080293),
FT                   complement(1079837..1079946))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824615"
FT                   /orf_name="Pc16g04680"
FT                   /product="Putative uncharacterized protein Pc16g04680 "
FT                   /protein_id="CAP93138.1"
FT                   /db_xref="UniParc:UPI0001831899"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Z8"
FT                   /transl_table=1
FT                   /translation="MQGKGLSLCLSVLGTPEYYSSNWEQFPRSGTLAVWNVGIVVQSLQ
FT                   GHEAFDPESCSYWVALPSTVSLSPEAYEVAMLTLLSASLSHVELGFGSMHGIATDDIRA
FT                   SCGGYRLRCTPPDAHMALTPD"
     atgcagggga aaggtctctc cctctgtctc tctgtactcg gtacaccgga gtactattct        60
     tccaactggg agcaattccc ccgatcagga acccttgcgg tctggaacgt gggaatagta       120
     gttcagagcc ttcagggaca tgaggcgttt gacccggaat cttgttcata ttgggtggcg       180
     ctaccatcta cagtttcact ttcccctgaa gcttacgagg ttgcaatgct gacactgctg       240
     tctgcttcgc tgtcccatgt cgagctcggc tttggctcga tgcatggcat cgccacagat       300
     gatatacgag cctcgtgcgg cggttatagg ttacgatgta caccgccgga tgcgcacatg       360
     gcactgaccc cggattag                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page