(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE469

PENCW_13.PE469       Location/Qualifiers
FT   CDS_pept        join(1080827..1081309,1081382..1081798,1081865..1082167,
FT                   1082222..1093826,1093878..1094969,1095018..1096633,
FT                   1096684..1099362)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207851" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948786"
FT                   /orf_name="Pc16g04690"
FT                   /product="Pc16g04690 protein"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="ligase activity"
FT                   /function="phosphopantetheine binding"
FT                   /protein_id="CAP93139.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="GO:0031177"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI0001834909"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Z9"
FT                   /transl_table=1
FT                   /translation="MAQSTKCYLPRFASTVDGPKRPVSMKTRPTAAQHAQLLTAWNEGR
FT                   LDPILRATWALLLHYYIRSEDICFGYQHLEGDSRSPKSSVQRSTVNISTIRISINDNDS
FT                   LKAIVDKVRANSAIRQNNGSPEASEAYLPFNTIFMLRTYDPPASPSKPILATAIPDECQ
FT                   VRLHVKVLRGDISIFLEWRKGDMSGEQMKSIANIFEQLLAKVLSAENTAISQLNLFSEN
FT                   DWQRIRKWNSTTPQLHDRCIHEAIHDQMLSGPDREAVCAWDGSLTFAELDHQASKLACY
FT                   LRMQGVGPEIRVALCFDKSKWNIVAMLGVMKAGGAFVPLDPSHPTSRLQGLIQSVEAPV
FT                   VLCSQHLADKLRPIVKTLIPLCADTLDPLSDPTDSVNLASGVTSQNAAYVLFTSGSTGE
FT                   PKGTLLEHRAFLSGAMVHGPGLRIYRDSRCLQFAAHTFDASLAETLTPLIHGACVCIPS
FT                   EEARLNDIVSTINEMRVTQACFTPSFIGFIEIESVPGLESLVLAGEAMSQSQLTTWSKI
FT                   KLVNGYGPTEASVASVLNSNVTPDTDCKDIGLPIGVRAWLVNPDNHDELVPVGCPGELL
FT                   LEGPPLARCYVNNPQKTNESFIYDPAWTTLDPETGSNRRFYKTGDLARYNSDTGALNYV
FT                   GRKDTQVKVHGQRIELGEIENQLSKDSNVTHCSVFFPKTGFSKGRLAAVVSSTGLLAEQ
FT                   SDSDLEPLRLVPASKKAELVPGIRERLSARLPTYMVPAVWLCVEALPLLPSGKLDRKGI
FT                   STWVAGMESDPDLQNGTSAAIVDAEASQPANDREEALAAVYSRVLNIPQNQLNLNESFL
FT                   ALGGDSIAAMTCIGLCKKRGFALSVQELLRSKSIRDLATRAKTIDHLTTYEEAVDEPFS
FT                   LSPIQSLHFGVRKEGQGHFNQGILTRLNKPVDERTLRKAVETLVSRHSMLRARFTDTGF
FT                   ATASSQHITRDIKGSYRWRMHTLANMNEVETHVADSQSSINCFSGPLLAVDYFLVKGRP
FT                   NVLSMTAHHLVVDIVSWRIILEDLEDIILNPEKTGTSDGSLPFQTWCRLQNEHCNTLRA
FT                   EHKVATDALAVPDFGYWGLKDTQTTYGDVDCASFEIDPAHTNAILLECHKALGTEPIDL
FT                   FLAAMLHSFGRAFPDRSLPTIYNEGHGREVWDPSIDISHTVGWFTILHPIFVSAYKSDS
FT                   PIDTLIQVKDLRRRVTDNGRADFTSRVLPAQGNQGSKHPHPFEMSFNYVGQHRDLQRKD
FT                   GLFQLVDQMAGEAGQGGGAADFGSDTPRFGLFEISAMVVAGKVRFNFSFNKFMQHQNRI
FT                   HRWVSECQELLVTLSEQLPTLEPRLTLSSFPMLSLTYPTLDKLLNEKLPAMGIESPDFV
FT                   EDIYPCSRMQQGILLGRKRDSSYYAVHDTFEIRATGSGKPNLDRLVNAWQKVVSHHAMF
FT                   RTIFVENLTPRDPFCQVVLKSYDATPVFLQSSGEKDVLATFDKEDPKDYSEPEPAYRFS
FT                   ICQTPTGRLFARIEISHAAMDGNSISIILRDLQLAYAGRLEESPQPLFKDYIQYMQDAP
FT                   NEASISYWRSYLDQAKPCHFPALTDGQQSAKALRSIPVNFGALDELQTVCEKRGITLAN
FT                   VFNAAWGLTLRAFCGSDDVSFSYMASLRDVSADGVQWVVGPVINLLICRMKVADDAKLS
FT                   DVLHQIQNDYMESLPYRHTSLIEIQHALKLSDTNLFNSGVSYRRLPSSKDAVSSEIECA
FT                   EVGSIHDPAEFPVFINIEAMDTTARIDLNYWTTNLSDSQAANVANTYLRCLENVVSNID
FT                   CEIRQLNNLSEDNRAQIMAWNSKTHKPFEKCAHHVVQEMAKKRSDALAVTAWDGNLTYS
FT                   KLDQFSSRLAGYLVTFGVGPGTLIPICFEKSIWNIVSTLAIMKAGGGCIPVDTPESLAA
FT                   VENWIVDNAVQVALASPEKAHVLEDAVPYVIPVSESLLEYLADEDLNPVAQSSDVAYVA
FT                   MTAGTSGPAKSVVLDHSTVMTRAEAFATTMAIADVSRTLQFAPHTSDAFIVEAFATFMW
FT                   GGCICIPADIDPLNLAACINALHVNVASITPTAASFFSPKDVPGLRSIALGGEVVPQSV
FT                   LDHWKTDDLQLQVLYGTCESSAASFHVFCSQEEHEAALIGKSTSCVSWVVDPSNHENLV
FT                   PIGSVGELALEGPVIASGYLDDQSVETSDFFENAPWLSGQRGGRKHRLFKTGDLVRYKS
FT                   DGSLVFVGRKNDKSQSALASELIQTQTRIDTFLEKKKCVVESVQLQRGDMKTNALVAFV
FT                   VFSDTIPVTYGDRVLQSATPGMKDAMSSLHASLSTSLPGSKVPSFYIPISSLPLTVSGK
FT                   LNRQALKFETQALSSSALEAFDIKHWNGSKTGNRAARQASLSGPNIAFWKEYLADVEPC
FT                   IFPALSHEASANARSIRTLNKQSANIHAFSRLSGLPVETLFQFAWAVVLRWYTGSDDVC
FT                   FGYSAAASETKSEADGVSTCRFLVQNEQKLQETLQKAKRDCETSALNVAPLDAVKHQLG
FT                   LDNTTLFNTSLIYRTASNLPKGSTREPSTSSAYKILVEAEVSHSYAEIHFTYSSDTLSS
FT                   FQVSHVMDMFDQVLDDLIAHNLRDRTIGDVNVLPERSVRRIRDWNAASPPRVEKCADEL
FT                   IQQQALLHPRAEAVCSWDKNFTYGQLEIVSSRLARHLSSLGVKPEAFVVLCFEKSAWAV
FT                   VAQLAVLKAGGAFVSIDPSHPDSRLKMLIDEIGTNLVLCSSSVHTKVSKLCTKSFAVCQ
FT                   TSISQLPDSPLALPGARPTPNNAAYAIFTSGTTGKPKATVVEHTALSTTAIAMIDGLHM
FT                   NSTTRALQFSNYTFDVSILEIMMILMTGGCVCIPSEDERMNNLGGAIRRMEATYISAPP
FT                   AIVNTLEPKNVPSLKVIITGGEKMPANHIDRWADRCVINAYGPSEATVVATVGVKVDWD
FT                   GNRVNDDPTSIGTSPNCRVWIVDPNNSNRLLPVGAVGELILEGSNIARGYLANEEKTKA
FT                   SFFENPVWNRHSGLQGVFKRNDRMYRTGDLVRYNSDGSLAFISRKDTQIKFNGQRIELE
FT                   EIEQQCIRCLPEDSQVAVDVVVPEERTIAKGLAAFFTVHDPDSNGGSNDQFAPTVPGAD
FT                   PLLLPISMSNMDAIQKLKGSLPELLPQSMMPRLFFPIRNLPFTSSGKIDRRRLRAMVQT
FT                   LSKDTLKSYITLTTSDRREISSATGLEIKLVALVEKTLELEAGSVTVDDSFFGLGGDSL
FT                   SAMNLVGAAQAEGIALTVSGIFNSPILVDMAKSCVVSDGPAEVKKEDIKAFSLLPSGVY
FT                   LENLMDEVTDSCEVSKDLISDIYPCSAVQEGLLTLSIKHNGAYVAQPSFRLAAGIDVGK
FT                   FKQAWQQTVSDLEILRTRIVHTEAMNFAQVVLKDGPISWVEAESFDSLPNDFLHLPKQN
FT                   GAALTGYAMVHPRGSSDSYFVWSVHHALYDGWSIPLVFRKVEENYFSSQPKRAGTPYSL
FT                   FIDYLAKKDMEESDAFWKSYLTDLSSTPFPHNKNAVPDAMRAGNTQYHNMKLSRTRNSV
FT                   DFTIPVLMRAAWAIVIATHTASGDVCFGETLSGRNIDLPGVADIAGPVLTTVPTRVQVD
FT                   NAMSTMQYLQKIHQSTTEMIPHLHSGLQRIRQLNKDTSEGCNFQNLLVIQPGDGELDNK
FT                   IWIDEKRETSEDFFTHPLVVECGITKTSISFTVHHDELVISGWHTKRLTEQFAHVLQQL
FT                   IALPKNSTSKLEDLEVVSPEDKAEIGTWNERIPLTVERTVQDFIREKSEETPNAQAVCA
FT                   WDGDITYREFWNLASGFANYLVSRGVGPEVFVPVCLDKSAWAMVTLISILIAGGGYVPL
FT                   DPSHPTSRHEEILADVGANMILCTPNYTNRYSRVVKTVIPISKETIKAYGALKSSSRRR
FT                   TDVKPTNMAYALFTSGSTGRAKGIIVEHRNVVSSIMAFAPWVRMDETSRVFQFASLTFD
FT                   AAVMETLAILMLGGTICVPSEDDRLNDVAGAIRRLNVTWTFLTPSIASIIEPSSVPSLK
FT                   HLVCGGEKMSNEVITKWANSVHLMNGYGPTETCVFAVIDNAVATNRDPGRIGYGIPSTL
FT                   TWIVDPDNHDRLTPLGAVGELALEGAPLAREYLKNPEKNAEAFTSDPAWIKDFTPAIPG
FT                   PRRIYKTGDLCYYNPDGSIQYISRKDHQVKLHGQRMELGEIEHRLSEDALTRHAVVVLP
FT                   KNGPLKQRLVTVMSLNSVAADTKLISDKPCELVDENELERHAYNELVEVQKNLENQLPI
FT                   YMVPQTWALIKKLPMLVSGKLDRKKITAWVEDIDDASYERIMADYDRIKRGKIEEKPQE
FT                   KEEKHGSLSIIREIFAQVLNISLQKVNVDRSFVSLGGDSITGMAVISRARKQGLVVTLH
FT                   DILQSRSLKELAQTASSKAPVSQREEKSGDGFALSPVQRLYFQSSDSFKGAARFNQSMT
FT                   VRIARRCEGEVLKRAVKAVIGQHAMFRARFSTSSDGTWQQKTAAVGSLQIPDRTFSNST
FT                   SQEVDESFQFRVHSVADIRGMVPKIAESQNCLDPLNGPILAADLFNLRTGGQVLFLVAH
FT                   HLCIDMVSWRIVLQDLEELVVSGSLSLDKALSFQSWCAMQTERAKIQDATISLPFTPEK
FT                   PSLLYWGMQGSPNVYGDIKMESFMLSEDTTKFILDGCHSVFRTDTVDILLSAIIYSFGR
FT                   TFTDRRVPTIYNEGHGREAWEADIDLSRTVGWFTTMAPLLVDSEARALNDIIKRVKDTR
FT                   RKIADNGRPYFAKNLLQDQGSDFPVPLEILFNYLGKMQQLERADSLFHHHGSVFDSSDF
FT                   AVAGDMGPQTARFALFEVSAIVIKERLNVAFTYNNKMQHQGSIRRWILQCKQTLDKDIL
FT                   TLKTATPEPTLSDYPLLPINYHGLQMLTASTFRKAGIRNKDDVEDIYPCSPMQEGLLLS
FT                   QLRDPNAYMFHTVFEIKDGKSGKVDAEGVARAWQALVDRHPVLRTIFVDSNYTGGSFDQ
FT                   LVLKNLSDNILRVQCQDSQVEEKLAAISLRDRNAMRQAKLSHQLTVCKTNTGRVILKLE
FT                   MNHAIIDGGSVDVLLRDLTLAYERKIAEGSGPLFSDYIKLIRTQSHSDALSHWKEYLGG
FT                   VHPCHLAPSAVFEAKRELKGVKMNFQRFPELLKFCERSSVTLANLTLSAWAIVLRQFVG
FT                   SDDVCFGYLSAGRDAPVDGIQDMVGIFINMLCCRVQFSDQQTLTDVSKSVQDDYIRCIP
FT                   HQSCSLASIQHELGWQGQSLFNTTLSIQNHSVAGGPKDKGLSFDLQHAHDPSEYAVTVN
FT                   VEIARGQEGILLRYWNDIVSDEEAQSLADTIAKVFTGFIESPAATLSQSTFASEAEPES
FT                   VDWDRSQTTLADKAKSTGEAIDSSAMQKIIDDRVHEIIGQMLREGKLTVPPIRTEGLSS
FT                   YGGHTDTIADSPYQLGIQGADDSGVCSATSRSSEDGMSVDVERKLWNLWSTALGLSPNV
FT                   VRHQDSFFKLGGDSITAMKMVSAAREEGLVLTVADVFNNPVFEDMLTTVRAANVTQQML
FT                   NADLKSGGHKEVDSDLLNITPTTLGPSPSTESLEVLKPSCVDDAAVQRGICPKVGVFKG
FT                   GIADVLPVTDFQAMSLTATLFKSRWMLNYFYLEGNGPLDLRRLRESCLKVVAAFDILRT
FT                   VFVCFHDQFFQVVLRKIRPSIFVYETDRALDEFTMTLQQRDREYGPREGEQYVQFYVVK
FT                   KKNSDQHRIMIRLSHTQYDGVCLPKIMAAIKHGYEGTPLPPVTPFAGYLRQLPGTITPD
FT                   HYRHWTDLLKGSHMTQVVRRRGTSMFQNVGAFTEIHRKIEISPTALGNVTIATVMQAAW
FT                   ALALAKLSAQSDVIFGLTISGRNATVPGIESTVGPCVNVIPVRVKFDEKWTGVDLFRYL
FT                   QDQQVSNMPFESLGFREIIKQCTDWPDWTYFTTSVFHQNVDYEGNMQLDNNKYRMGGVG
FT                   VNDNLADLTMVSRPSGERGLDVTLGYSEKGPVMPSFASKVLDMACEIAQSLVANPTASL
FT                   PSASMLRSLPPQTIDDQPRPTDEHFLSAHLKSRSIAELLVHSDILSRSWHQVLPSRTTT
FT                   GPVDPEADKPTHQSAFQLDSSFFDLGGDVFNLAQLTWLLEQEGLKVRLEDLIEHPSFLG
FT                   QMAVLALHNAKHQEDMPTELLATGAAPPDPVARIEKKKTWSKAMTIARKLTGRNTVTSR
FT                   A"
     atggctcaat ccaccaagtg ctatcttcct cggttcgctt cgacggttga cgggcctaaa        60
     cgcccagtct cgatgaagac gagacccacg gctgctcagc atgcgcagtt attaaccgca       120
     tggaacgaag gccgtctgga ccccatccta cgagccacct gggctctctt gttgcactac       180
     tatatccgct ccgaggatat atgcttcggt taccaacatc tcgagggcga ctcgcgctct       240
     cccaaatcat ctgtacagcg ttctaccgtc aacatttcga cgatccgcat atccatcaac       300
     gacaacgact ctctcaaagc aattgtagat aaggtgcgcg caaacagtgc gattcgccag       360
     aacaatggaa gccccgaggc ttccgaggca tatcttcctt tcaacaccat cttcatgctg       420
     cgcacatacg acccgcctgc ttctccttca aaacctattc tggcgacagc tattccggac       480
     gagtgtcaag tccgtcttca tgtcaaggtg ctgcgtggag acatcagcat cttcctcgaa       540
     tggcgcaagg gtgacatgtc cggggaacag atgaagagta tcgcaaacat ttttgagcag       600
     ttgcttgcca aagtgctttc tgccgagaac accgctatta gccagcttaa tttgttctcg       660
     gagaacgact ggcaacgcat ccgcaagtgg aattccacta ctccacagct tcacgatcgc       720
     tgcattcacg aggccatcca cgatcaaatg ttgagcggac ctgatcgtga ggctgtgtgt       780
     gcgtgggatg gaagtttgac gttcgccgag ttggatcacc aagcgtcgaa gcttgcatgc       840
     tatcttcgca tgcagggagt cgggccggaa atccgcgtgg ctttgtgttt tgataaatcg       900
     aaatggaata tcgttgcaat gcttggcgtg atgaaagccg ggggagcctt cgtcccattg       960
     gacccaagtc acccaacttc ccgactgcaa ggtctcatcc aatcggttga ggcaccggtt      1020
     gtgctgtgct ctcagcatct tgccgataaa cttcgtccga tcgtaaagac tttaataccc      1080
     ctctgtgctg atactctcga tcctctgtcg gaccccaccg acagtgtcaa tcttgcatct      1140
     ggtgtcacaa gtcaaaatgc ggcttatgtt ctgtttacct ctggatcaac aggagaaccc      1200
     aaggggactc tcttggagca ccgcgcgttc ctgtccgggg cgatggtgca tggacccggg      1260
     ctgcgcattt atcgcgactc gcgatgcctt caatttgccg cccacacatt cgatgctagt      1320
     ttagccgaga cattgacgcc gctcattcat ggtgcgtgcg tgtgcattcc gagcgaggaa      1380
     gctcggctca acgatattgt gagcaccatc aacgagatgc gagtcaccca agcttgcttc      1440
     accccgtcat tcatcggctt tattgaaatc gagagcgttc caggactgga gagtttggtc      1500
     ctggccgggg aggcaatgtc gcagtcacag ctgactacct ggtccaaaat caaactggtc      1560
     aatggttatg gacctaccga ggccagcgtg gcgtccgtcc tcaactccaa tgttacacct      1620
     gacaccgatt gcaaagatat cggactgcct attggtgtaa gagcttggct ggtgaaccct      1680
     gataaccacg atgaactggt ccccgtgggc tgccctggag aactactttt ggaaggccca      1740
     cccctggccc ggtgctacgt gaataatccc caaaagacaa acgaatcatt catctacgac      1800
     cctgcttgga ctacattgga ccctgaaact ggctcgaatc gtagattcta caagacaggt      1860
     gatctcgcca ggtacaactc cgacactggt gccctgaact acgtcggtcg caaggataca      1920
     caggtcaagg ttcacggaca acggatcgag ctcggcgaaa ttgagaatca gctcagcaaa      1980
     gattcgaacg tcactcattg ctctgtcttt ttccccaaga ctgggttttc caagggacgc      2040
     ctggcggcag ttgtgtcgtc cactggtttg cttgcggaac agtctgattc ggacttggaa      2100
     cctctacgac tagtccccgc ctcgaaaaag gctgagcttg tccctggcat ccgagagcgt      2160
     ctatcagctc gcctccccac ttacatggtc cctgcggtgt ggttgtgtgt cgaagctctg      2220
     ccacttctgc catcagggaa gctagaccgc aagggcattt ccacttgggt cgccggtatg      2280
     gagagcgatc cggatcttca gaacggtacc tccgctgcaa ttgtcgacgc agaagcctca      2340
     cagcccgcca acgacagaga ggaagcttta gccgctgtat atagccgtgt cctcaacatt      2400
     ccccagaacc agctcaattt gaatgagagc ttcctcgccc tcggtggtga ttcgatcgca      2460
     gctatgacat gtatcggtct atgtaagaag cgagggtttg ccctctctgt acaggagcta      2520
     cttcggagca aatcaatccg cgacctcgca actcgcgcaa agacgattga tcaccttacg      2580
     acttacgaag aagctgttga cgaaccgttc agcctgtccc ccatccagag ccttcacttc      2640
     ggtgtacgca aggagggcca aggccacttc aatcaaggaa tcctgactcg cttgaataaa      2700
     cccgtcgacg aaaggaccct ccgcaaggct gtcgaaacgc tggtatctcg gcactccatg      2760
     ctccgtgcac gattcactga cacaggtttc gcgacggcgt ccagtcaaca cattactcgc      2820
     gatatcaagg gatcttacag atggcgaatg cacactcttg ccaacatgaa cgaggtcgaa      2880
     actcatgtcg ccgacagcca atcctctatc aactgctttt ctgggccact gctggcagtg      2940
     gattatttct tggtgaaggg ccggcctaat gtcctgtcaa tgacagctca tcacttggtc      3000
     gtcgacattg tctcttggag aattattctg gaagatttgg aagacatcat tctaaacccc      3060
     gagaagactg gaaccagtga tggttcgttg cctttccaga cctggtgccg cctgcagaat      3120
     gagcactgca acaccctacg tgctgagcac aaagttgcaa ctgatgctct cgctgtaccc      3180
     gactttggtt actgggggct caaagacact caaactactt atggagatgt ggattgtgcc      3240
     tcgtttgaga tcgacccagc tcataccaat gctattctgc tggaatgtca caaagctctt      3300
     ggcaccgagc caattgactt attcctggca gcaatgctcc actcatttgg ccgcgctttc      3360
     cccgatcgtt ctcttccaac gatctacaat gaaggccacg gacgcgaagt ctgggacccg      3420
     tccattgata tttcgcatac tgttggctgg ttcaccattc tgcacccaat ctttgtctca      3480
     gcatacaagt cagacagccc cattgatacc ctcatccagg ttaaggatct tcgccgtcgc      3540
     gtcacggaca atggccgcgc agatttcacc agccgtgtac tcccagctca gggcaatcaa      3600
     gggtccaagc accctcatcc cttcgagatg tcattcaact acgttggaca acaccgagat      3660
     ctacaaagga aggatggtct cttccaactt gttgatcaga tggcaggaga agctgggcaa      3720
     ggaggcggcg ccgctgactt cggatcagat actccccgct ttggtctgtt tgagatctct      3780
     gcgatggtcg tggctgggaa ggttcgattc aacttctcct ttaacaagtt catgcagcac      3840
     cagaatcgta ttcaccgatg ggtttccgaa tgccaggagc tgcttgtaac cctctctgag      3900
     cagcttccga ccctcgagcc gcgtttgact ctcagctcgt tcccaatgct gtcgctgacc      3960
     taccctacct tggacaagtt gctcaatgaa aagttgcctg ctatgggtat tgagtcccct      4020
     gactttgttg aggatatcta tccttgttct cgcatgcagc agggtatcct acttggtcgc      4080
     aagcgagata gctcctacta tgctgtccac gacacctttg aaattcgggc cactggatct      4140
     ggcaagccaa acctcgatcg cctggtcaat gcatggcaga aggtcgtttc tcatcatgcg      4200
     atgttccgca caatcttcgt tgagaacctc actcctcgcg accccttctg ccaggtcgta      4260
     ctgaagagtt atgatgctac tcctgttttc ttgcagtctt caggggaaaa ggacgtgctg      4320
     gccacgtttg acaaggaaga ccccaaggat tacagcgagc ctgaaccagc gtatcgtttc      4380
     tctatttgcc agacacccac tggcagactg tttgctcgca ttgagatcag tcatgcggcg      4440
     atggacggta actccatctc catcattctc cgtgacttac agctcgcata tgcaggcaga      4500
     ctcgaggaaa gccctcagcc tttgttcaag gattatatcc agtacatgca ggatgcgccg      4560
     aacgaagcta gcatcagcta ctggcgttcg tacttggatc aagctaagcc gtgccacttc      4620
     cccgccctca ctgacggcca acagtcagca aaggcacttc ggtctattcc tgtcaacttt      4680
     ggggccctag acgaactcca aactgtctgc gagaaacgcg gaatcactct cgcaaatgtc      4740
     ttcaatgccg catggggcct tactctccgc gcgttctgtg gatccgacga tgtctccttt      4800
     agttacatgg cttccctgcg tgatgtttct gctgacggcg tccagtgggt ggtcggacca      4860
     gttatcaacc ttctaatctg tcgcatgaag gttgccgatg atgcgaagct cagtgatgtg      4920
     ctacaccaaa tccagaacga ctacatggaa agccttcctt atcgtcacac ttcgctcatc      4980
     gagatccagc atgctttgaa gctgtccgac accaatttgt tcaattccgg tgtctcctac      5040
     cgccgtcttc ccagttctaa ggatgctgtc agcagcgaaa tcgagtgtgc tgaggttggc      5100
     tcaattcacg atcccgccga gttcccggta ttcatcaaca tcgaggccat ggataccacg      5160
     gctcgcattg acctcaacta ctggactacg aatctctctg attcacaggc tgccaatgtg      5220
     gccaatacat accttcgatg ccttgagaac gttgtgtcga acattgactg tgaaatccgc      5280
     cagctaaaca acttgagcga ggataaccgt gcccagatca tggcgtggaa cagtaagact      5340
     cacaagccct tcgaaaagtg cgcccatcac gttgtccaag agatggccaa gaagcgctct      5400
     gatgccttgg ctgtaactgc ttgggatggg aacttgactt actccaagtt ggatcaattc      5460
     tcctcccgat tggcaggcta tcttgtcact ttcggtgtgg gtcccggcac actgatcccc      5520
     atctgcttcg agaagtctat ctggaacata gtctccacat tggcaatcat gaaagccggt      5580
     ggtggctgta ttccagttga cacacccgag agtctcgctg ctgttgagaa ctggattgtc      5640
     gacaacgccg tccaagtcgc tctggcttcc ccggagaagg ctcacgtcct cgaggatgcc      5700
     gtaccgtacg tcatccctgt aagcgagtct cttctcgagt acctcgcgga cgaggatctc      5760
     aaccccgtgg cacaatcatc agacgtcgca tacgtcgcta tgactgccgg tacctccggc      5820
     cccgctaaga gtgtcgtcct tgaccattca actgtcatga cccgagccga ggcattcgct      5880
     accaccatgg caattgccga tgtctccagg actctgcaat tcgcacccca tacatccgat      5940
     gcatttattg tcgaggcatt cgccactttc atgtggggtg gttgcatttg cattccggct      6000
     gacattgacc ctctcaactt ggctgcctgt atcaatgcgc tccatgttaa tgtcgcgagc      6060
     atcaccccga cagccgcaag cttcttctcc cccaaggatg ttccgggcct gcgatcgatc      6120
     gccctcggcg gcgaagttgt gccccagagc gtgctcgacc actggaagac cgacgacctc      6180
     caattgcagg ttttgtatgg aacatgcgag agctcagcgg cctccttcca tgtgttctgt      6240
     tctcaggagg agcacgaggc tgcgctcatt ggaaagagca cgtcctgtgt ttcatgggtg      6300
     gttgacccct ccaaccacga gaaccttgtt ccgatcggct ctgtgggaga attggccctc      6360
     gagggccctg ttattgcctc gggctacctc gacgaccagt ctgtagagac cagtgacttt      6420
     ttcgagaacg ctccttggct ttctggacaa cgaggagggc gtaaacaccg tcttttcaag      6480
     accggggatc ttgttcggta caaatccgat ggctccctcg ttttcgtcgg ccgaaagaat      6540
     gataagagtc aatccgcctt ggctagcgag cttatccaga ctcagacgcg catcgataca      6600
     ttcctggaaa agaagaagtg tgttgtggaa agcgtccagc tgcaacgtgg cgacatgaag      6660
     acaaatgccc ttgttgcttt cgtggtcttc tcggacacca tcccagtcac ttatggggac      6720
     cgcgtcctcc agtccgcaac gcccggaatg aaagatgcca tgtctagctt gcacgctagt      6780
     ctgagtacca gtcttcctgg tagcaaggtt ccgagtttct acatccccat ttcctccctc      6840
     cccttgaccg tctctggaaa gctaaaccgc caggccctca aattcgaaac acaagcgctc      6900
     tcgagcagtg ctctcgaggc tttcgacatt aagcattgga acggatccaa gactggtaac      6960
     cgggctgcac ggcaggccag tctctccggg cccaacatcg ctttctggaa ggagtatctc      7020
     gccgacgttg agccctgcat tttcccggcg ctctcccatg aagcaagcgc caatgcccgc      7080
     tccattcgca cgctcaacaa gcagtcagcc aacatccatg ccttcagcag attgtctggc      7140
     ctgcctgtag aaactctctt ccagttcgcc tgggcggttg ttctccggtg gtacactggc      7200
     tcagacgatg tttgctttgg atattccgcc gcagcctccg agacgaaatc ggaggccgat      7260
     ggagtttcca cctgccgttt cctcgtacag aacgagcaaa agctgcagga gactctccaa      7320
     aaagcaaaga gggactgtga gaccagtgca ttgaatgtcg ctcccttgga cgcagtcaag      7380
     caccagcttg gactcgataa cacaacgctc ttcaacacct ccctgattta ccgcacggct      7440
     tccaatctcc ccaagggaag tacccgggag ccaagcacct ctagtgctta caagatcttg      7500
     gttgaagctg aagtctcgca ttcgtacgcc gagatacact tcacctactc ctcagacacc      7560
     ctttcctcct tccaggtcag ccatgtcatg gacatgtttg accaagtctt ggacgatttg      7620
     atagcccaca acctccgtga ccgcaccata ggggacgtca atgtactccc tgaacgctca      7680
     gttcgtcgaa tccgcgattg gaatgccgca tcccctccta gagtggagaa atgcgccgac      7740
     gaactcatcc agcagcaggc cctcctccac ccccgcgccg aagccgtctg ctcttgggac      7800
     aagaatttca cctatgggca acttgaaatt gtgtccagtc gcctggctcg tcatctctcc      7860
     agccttggag tcaagcccga agcctttgtg gtgttgtgct tcgagaagtc agcttgggct      7920
     gtagtggccc agctggctgt tctcaaggcg ggtggagcct tcgtctcgat tgacccatcc      7980
     caccccgatt ctcgactgaa gatgcttatc gatgaaattg gcactaacct tgtcttgtgc      8040
     tcgtcctcag tccacaccaa ggtttcgaaa ctgtgcacta aatcattcgc cgtctgccag      8100
     acttcaatct cccaacttcc tgattcgcct ttggctctgc ccggtgctcg tcctactcca      8160
     aacaatgctg catatgctat atttacctct ggtactactg gaaagcccaa ggcaactgtc      8220
     gtcgaacata ctgcccttag caccaccgcg atcgccatga tcgacggcct gcacatgaac      8280
     tccacaaccc gtgctttgca gttctctaac tacacctttg acgttagcat cttggagatc      8340
     atgatgattc tcatgactgg tggctgtgtc tgtattccca gcgaggatga gcggatgaac      8400
     aacttgggtg gtgccatccg ccgaatggaa gccacctaca tctcggcacc tcctgccatt      8460
     gtcaatacac tagagccgaa aaacgtccct agcctcaagg tcattatcac aggcggcgag      8520
     aagatgcccg ccaaccatat tgaccgctgg gcagaccggt gtgtcatcaa tgcctatggt      8580
     ccctccgagg cgacagtcgt tgctacagtt ggtgtcaagg ttgattggga tggaaaccgt      8640
     gtcaacgatg accccacatc tattggaaca tctccaaatt gcagagtctg gattgtcgat      8700
     ccgaacaact ccaaccgtct gctgcccgtt ggcgctgtcg gtgagctgat ccttgaagga      8760
     agcaacattg cccgtggata ccttgccaac gaggaaaaga cgaaggcctc tttcttcgag      8820
     aatcctgtgt ggaaccgtca ttccggctta cagggcgtgt tcaagcggaa cgatcgcatg      8880
     taccgtactg gtgatcttgt tcgctacaac agtgatggca gtctggcttt catctcccgc      8940
     aaagacactc agatcaagtt caacggccag cgaattgaac tggaggagat tgaacaacaa      9000
     tgtatccgct gcctacctga agattctcag gttgctgttg acgtcgttgt ccccgaggaa      9060
     cggaccatcg ccaagggtct cgccgcattc ttcacggttc atgacccaga ttccaacggc      9120
     ggcagcaacg atcaatttgc ccccacggtt cctggagccg atccactgct cctgcctatc      9180
     tccatgtcca acatggatgc cattcagaag ttgaagggct ctctgcccga actcctacct      9240
     cagagcatga tgcctcgact cttcttccct atccgcaact tgcccttcac ttcctcggga      9300
     aagattgacc gccgaagatt gcgggccatg gtacaaacct tatccaagga tactcttaag      9360
     tcttacatta ccctcaccac ctccgacaga cgggagattt cctcagctac cggcctcgag      9420
     atcaagctgg tggcccttgt cgaaaagacc ctcgagcttg aagctggatc tgtgaccgtc      9480
     gatgacagct tcttcggtct gggtggtgat tccttgtccg ccatgaacct cgtcggcgct      9540
     gctcaagcag aaggcatcgc actcaccgtc tcgggcatct tcaattcccc gatattggtt      9600
     gacatggcca agagctgcgt cgtgtctgac ggccctgctg aagttaagaa agaagatatc      9660
     aaggcattct cattgctgcc ctctggagtc tacctcgaaa atctgatgga tgaagtcacc      9720
     gacagctgcg aagtgtccaa ggaccttatc agcgatattt acccatgcag cgctgtgcag      9780
     gagggtcttc tcacgctctc tatcaagcat aacggtgctt atgttgctca gccctcgttc      9840
     cgtcttgctg ctggcattga tgtcggtaaa ttcaaacagg cctggcagca aacggtgtca      9900
     gacttggaaa tccttcgcac tcgcattgtc cacactgaag ctatgaactt tgctcaagtt      9960
     gtcctcaagg atggccccat ctcctgggtc gaagcagagt cgttcgattc tctgcccaac     10020
     gatttccttc accttcccaa gcaaaatgga gcagctctca ctggttacgc catggtgcat     10080
     ccccgtggct cgtctgacag ctactttgtg tggtctgttc accacgccct ttatgacggc     10140
     tggagtattc ctctggtatt ccgcaaggtc gaagagaact acttttcctc acagcccaag     10200
     cgcgctggca ccccttacag tctgttcatc gactatctgg ctaagaagga tatggaggag     10260
     tctgatgctt tctggaagtc ttacctgact gatctgtcca gcactccttt ccctcataac     10320
     aagaacgctg ttcctgatgc catgcgtgct ggcaacaccc agtatcacaa catgaaactt     10380
     tcccgcaccc gcaacagcgt cgactttacg atccccgtcc tcatgcgcgc tgcatgggca     10440
     attgtcattg ctacacacac tgcctccggt gatgtgtgct tcggcgagac tctgtcgggt     10500
     agaaatatcg atctccccgg tgttgcagat attgctggtc ctgttctgac cactgtcccc     10560
     acccgagtcc aggttgacaa tgctatgtcc actatgcagt acttgcagaa gatccaccag     10620
     tcgaccaccg agatgatccc acatttgcac tctggtcttc agcgtatccg gcaactgaac     10680
     aaggatacct ccgagggttg caatttccaa aacttgcttg tgatccagcc aggcgatggc     10740
     gaactcgaca acaagatctg gatcgacgag aaacgtgaaa caagcgaaga cttcttcact     10800
     cacccccttg ttgtggaatg tggaatcacg aagacaagca tctccttcac cgttcaccac     10860
     gatgagcttg tcatcagcgg atggcacacc aagcgactta ccgaacaatt tgcacatgtt     10920
     ctgcagcagt tgattgcctt gcctaagaac agcacgagca agctcgaaga tttggaggtc     10980
     gtaagccccg aggacaaggc tgaaattggt acatggaacg agcgcattcc cctcacagtg     11040
     gaacgaaccg tccaagattt cattcgtgag aagtccgagg agactccgaa tgcccaggct     11100
     gtatgtgcct gggatggcga catcacctac agagaattct ggaacctggc ctctggcttt     11160
     gccaactacc ttgtctctcg cggagttggc ccagaagtgt ttgttccggt ctgtctggac     11220
     aagtcagctt gggcaatggt cacccttatc agtattctca tcgccggtgg tgggtacgta     11280
     cctttggatc cctcccaccc tacctcgcga cacgaggaaa tccttgccga cgtcggtgcc     11340
     aacatgatac tatgcacccc caactataca aaccgctaca gtcgggttgt gaagactgtt     11400
     atccccatca gcaaggagac gatcaaggcc tatggcgcac tcaagtcatc ttcccgtcgc     11460
     cgaactgacg tcaaacccac caacatggct tatgctctat tcacctctgg gagcactggt     11520
     cgggccaagg gaattattgt cgagcaccgc aatgtggtca gcagcatcat ggcattcgcc     11580
     ccgtgggtac gcatggatga gacatcgaga gtattccaat tcgcctccct cacttttgat     11640
     gctgctgtta tggagactct tgcgattctc atgctcggag gtaccatatg tgtgcccagc     11700
     gaagatgacc gtctcaacga tgttgcgggc gcaattcgtc gactcaatgt cacttggacg     11760
     ttcctcaccc cttcgattgc aagcatcatt gagccatcct cagtgccttc tctcaagcac     11820
     ctcgtttgtg gtggagagaa gatgtctaat gaagtcatca ccaagtgggc caattctgtt     11880
     cacctcatga atgggtacgg accgaccgag acctgtgtct ttgctgtgat cgacaatgca     11940
     gtggccacta accgtgatcc cgggcgtatc ggttacggta ttcccagcac tctcacttgg     12000
     attgttgacc ccgacaacca tgatcggctg actcctctgg gcgcagtcgg tgaacttgca     12060
     cttgaaggtg ctccgttggc cagagagtac ctcaaaaacc ccgagaaaaa cgcagaagca     12120
     ttcacttcgg accctgcctg gatcaaggac ttcacccctg cgatcccggg tcctcgccga     12180
     atctacaaga ctggcgatct ttgctactac aaccctgacg gatcaattca gtacatcagc     12240
     cggaaggatc accaggtcaa attgcatggc cagcggatgg agcttggtga gatcgagcat     12300
     cgcctctctg aagatgctct tacccgccac gctgtcgtcg tgctccccaa gaacggcccg     12360
     cttaagcagc gcctggtcac tgtgatgtct ttgaacagtg tggcagctga taccaagctt     12420
     atttctgaca agccctgtga gcttgttgac gagaatgagc ttgagcgcca cgcttacaac     12480
     gagctggtcg aagtgcagaa gaatcttgag aaccagctgc ccatttacat ggttccgcag     12540
     acttgggctc tcattaagaa gcttcccatg ctcgtttcgg gaaagctcga ccggaagaag     12600
     atcactgctt gggttgagga tattgatgat gcatcctacg agcgtatcat ggccgattac     12660
     gatcgcatca agcgtggcaa gatcgaggag aagccgcaag aaaaggaaga gaagcatgga     12720
     tcgctcagca ttatccgcga gatctttgca caagtgttga atatctccct acagaaggtc     12780
     aacgtcgatc gctcctttgt cagcttgggc ggcgacagca tcactggaat ggctgtcatt     12840
     tctcgcgctc gcaaacaagg acttgtcgtg acactacacg acattctgca gagcagatca     12900
     ctgaaggaac ttgctcaaac tgccagctcc aaggcgcctg tttcacagcg cgaagagaag     12960
     tctggtgatg gtttcgcact ctctcctgtc caaaggctct acttccagag ctcggactcg     13020
     ttcaagggcg ccgctcgctt caaccaaagc atgactgttc gcatcgctcg tcgttgtgag     13080
     ggtgaggtcc tcaagcgcgc cgtcaaggct gttattggcc agcatgccat gttccgcgcg     13140
     cgcttcagca catctagtga cggcacttgg caacagaaaa ctgcagcggt aggctcccta     13200
     caaatccctg atcgaacatt ttctaactca acctcacagg aggtcgatga atctttccaa     13260
     ttccgcgttc actctgtggc cgatatccgt gggatggttc caaagattgc tgagagtcaa     13320
     aattgtctcg atcctctcaa tggacctatt cttgcagccg acttgtttaa ccttcgcacc     13380
     ggtggtcagg tcttattcct cgtcgctcac catctctgca ttgacatggt atcatggcgc     13440
     atcgtgctcc aggacctcga agagctcgtt gtctctggat ctctttcact cgacaaagca     13500
     ttgtccttcc aaagctggtg tgccatgcag acggagagag ccaagataca ggatgcgact     13560
     atttctctgc ctttcactcc tgagaagccg agcttgcttt actggggcat gcaaggttca     13620
     cccaatgttt acggagacat caagatggaa tccttcatgt tgagtgagga tactaccaaa     13680
     ttcatcctgg atggctgcca cagtgtcttc cggactgaca ctgtcgacat tttgctgtct     13740
     gccatcattt attccttcgg tcgcaccttc actgatcgca gggtgccaac tatttacaac     13800
     gaaggacatg gcagagaagc ctgggaagcc gacattgatc tttccagaac agttggctgg     13860
     tttaccacaa tggccccttt gctagtggac tccgaagctc gtgccctcaa cgacattatc     13920
     aagcgtgtga aggacaccag gaggaagatc gcagacaatg ggcgtcctta cttcgccaaa     13980
     aacctgcttc aagaccaggg ttccgatttc cctgtcccgt tagaaatcct gttcaattac     14040
     ctgggtaaga tgcagcaact tgagcgagct gattcgctat tccatcacca tggtagcgtc     14100
     tttgacagct cggactttgc tgtcgcaggt gacatgggcc cccagactgc tcgtttcgcc     14160
     ctcttcgagg tatccgccat tgtcatcaaa gaacgcctta atgttgcttt cacctacaac     14220
     aacaaaatgc agcatcaggg ctctattcgc cgctggattc tccaatgcaa gcagaccctc     14280
     gataaggata tcctcaccct caaaacggcc actccagagc ccactctcag cgactacccc     14340
     ctcctcccaa ttaactatca cggcctccag atgctcactg ccagcacctt ccgcaaggcc     14400
     ggcattcgga acaaggacga cgtcgaggac atatatccct gctctccgat gcaggaggga     14460
     ctcttgctca gccagctccg cgatcccaat gcgtacatgt tccatactgt gtttgagatc     14520
     aaggatggca aatctggcaa ggtcgacgct gagggagttg cccgcgcttg gcaggccctc     14580
     gtcgaccgtc atcctgtgct ccgaactatt ttcgtcgaca gcaactacac gggcggatcc     14640
     ttcgatcaac tggtgctcaa gaatctttcc gacaatatct tacgcgtgca atgccaggac     14700
     tcacaggttg aggagaagct ggctgccatt tccctccgtg acaggaacgc aatgcgccaa     14760
     gcgaagcttt ctcatcaatt gacagtttgc aaaacgaaca ccggacgtgt aattctcaag     14820
     ctggagatga accatgccat catcgacggt ggctcggtgg atgtactcct ccgtgacctg     14880
     actctcgcct acgagcgaaa aattgccgag ggttcaggac ctctcttcag cgactacatc     14940
     aaactcatca ggactcaaag ccatagtgac gcactcagtc actggaagga atacctcggc     15000
     ggagttcacc catgtcacct cgccccatcg gctgtgttcg aagccaagag ggaactaaag     15060
     ggtgtcaaga tgaacttcca gcgattccct gagttgctta aattctgcga gcgaagctcg     15120
     gtgactctcg ctaacttaac cctttccgct tgggccatcg ttttgcgaca gttcgttggg     15180
     tccgatgacg tttgtttcgg atatctctct gccggtcgcg atgcccctgt cgatggcatt     15240
     caggacatgg ttggaatctt tattaacatg ctttgctgcc gagtccagtt ctccgatcag     15300
     cagaccctga cggatgtgtc caagagtgtt caggatgatt atattcgatg cattccccac     15360
     caaagctgct ctttggcgag cattcagcat gagcttggtt ggcagggaca gtccctcttc     15420
     aatactacct tgtcgatcca gaaccactcc gttgcgggtg gtcccaagga caagggactg     15480
     tccttcgatc ttcaacatgc acatgacccg agcgagtacg cggtcactgt gaacgttgag     15540
     attgcgcgag gccaggaggg tattcttttg agatactgga atgatattgt gtctgacgag     15600
     gaggcacaga gcctggctga caccatcgcc aaggtgttca ctggctttat tgagtccccg     15660
     gctgcgactc tgtcgcagtc cacattcgct tctgaggctg aacctgagtc ggtggattgg     15720
     gatcgctccc aaaccacact ggctgacaag gcaaagtcga ccggagaggc tattgacagc     15780
     agtgctatgc agaaaattat tgatgatcgt gttcatgaga ttattgggca gatgttgaga     15840
     gaaggaaaac tgacggtgcc tcccattcgc acagaagggt tgtcaagcta tggcggtcac     15900
     actgatacca tagccgactc accgtaccag ttaggtatac aaggagcaga tgattcgggt     15960
     gtttgttcgg cgacttcccg ttccagcgag gatgggatgt cggtcgatgt ggaaaggaaa     16020
     ttgtggaatc tttggagcac agctcttggc ctctcaccta acgtggtgag acaccaggac     16080
     agcttcttca agttgggcgg tgacagcatc accgccatga agatggtcag tgccgctcgt     16140
     gaagagggcc tggtccttac tgttgcagat gtcttcaaca atcctgtctt cgaggacatg     16200
     ttgacaacgg tgcgagccgc caatgtcact cagcagatgc tgaatgccga tctcaagtca     16260
     ggcggccaca aggaggttga cagtgattta ctcaatatca ccccaacgac actggggccc     16320
     agcccctcta ccgagagcct cgaggttctc aagccatcgt gtgtcgatga tgccgcggtg     16380
     cagcgcggta tctgtcccaa ggttggtgta ttcaagggtg gcatcgccga tgtcctccct     16440
     gtcactgact tccaggcgat gtctctgacg gcgactctct tcaagtctcg atggatgctt     16500
     aactacttct atcttgaggg caacggtccc ctggacctga gacgccttcg cgagagttgc     16560
     ttgaaggttg tcgctgcatt tgatattctg cgcacagtct ttgtgtgctt ccatgaccag     16620
     ttcttccagg tcgtgctgcg caagatccgt cccagcatct tcgtttatga gacggaccgc     16680
     gctcttgatg aattcaccat gacccttcaa cagagagatc gtgaatacgg accgcgcgag     16740
     ggcgagcagt acgtgcagtt ctacgttgtc aagaagaaga acagcgacca gcaccgtatc     16800
     atgatccgcc tctctcacac tcagtacgat ggagtgtgct tgccaaagat catggctgcc     16860
     attaagcacg gatatgaagg caccccactg cctccggtta cccccttcgc tggttacttg     16920
     cgacagttgc caggaacaat caccccggac cattaccgcc actggacgga ccttctcaag     16980
     ggctctcata tgacccaagt tgtccgcaga cgcggtacca gcatgttcca gaacgttgga     17040
     gcattcaccg agatccacag aaagattgag atctcgccca ctgccctcgg aaatgtcact     17100
     atcgcaactg tcatgcaggc tgcctgggcc ctggcccttg ccaagctctc tgctcagtct     17160
     gatgttatct ttggcctgac tatcagcggc cgcaacgcca cagtgcccgg tatcgagagc     17220
     accgttgggc cctgtgtcaa tgtcatcccg gtccgcgtga agttcgatga gaaatggacc     17280
     ggtgtcgatc tattccgcta cctccaggac caacaggtct ccaacatgcc tttcgagtcc     17340
     ctgggcttcc gcgagatcat caagcaatgt accgactggc ccgactggac ctacttcacc     17400
     acctcagtct tccaccagaa cgtcgactac gaaggaaaca tgcagctcga caacaacaag     17460
     taccgcatgg gtggtgtcgg cgtcaatgac aacctagccg atctcaccat ggtatcccgt     17520
     ccttccggcg aacgaggcct cgatgtcacc ctcggctact ccgaaaaggg ccctgtgatg     17580
     ccatcgttcg catccaaggt tctcgacatg gcctgtgaga ttgcgcaatc cctcgtcgcc     17640
     aacccaaccg cctccctgcc ctccgccagc atgctacgct ccctgccacc gcagacaatc     17700
     gacgatcaac cccgaccaac agacgagcac ttcctcagcg cgcacctcaa gtcgcgctcc     17760
     atcgcagagc tgctcgtgca ttcagacatt ctgtctcgct cgtggcacca ggtcctgccc     17820
     agtcgcacca cgaccggccc cgtcgaccca gaagcggaca aacccaccca ccaatccgcc     17880
     ttccagttgg actcgtcctt ctttgatctc ggcggtgacg tcttcaattt agcccagctt     17940
     acctggctcc tggagcaaga gggtctcaag gttcgtctgg aggatcttat tgagcacccc     18000
     tctttcctgg gccaaatggc cgtgctggct ttgcataacg ccaagcacca ggaggatatg     18060
     ccaacggagc ttcttgctac cggtgctgca ccgcctgatc ctgtcgctcg cattgaaaag     18120
     aagaagacat ggtccaaggc catgaccata gcgagaaagt tgactgggcg aaacacggtc     18180
     accagtcgag cttga                                                      18195
//

If you have problems or comments...

PBIL Back to PBIL home page