(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE47

PENCW_13.PE47        Location/Qualifiers
FT   CDS_pept        join(103308..103392,103448..103643,103715..103779,
FT                   103830..104356)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076648" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945524"
FT                   /orf_name="Pc16g00470"
FT                   /product="Pc16g00470 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="transition metal ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92717.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0046914"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniParc:UPI0001831157"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V8"
FT                   /transl_table=1
FT                   /translation="MKLTNIALTSAAIGLANAGLVSKRAVSDADILNYALTLEHLEASF
FT                   YEEGLKNFTQEDFVKAGMKDPFYANLKEVASDEKEHVDFLTSALKGMSLCTYNFPSADV
FT                   NGFLALASVLEGVGVSAYLGAAASIMSENYLTAAGSILTTEARHSAYLRAAVGEVPFAQ
FT                   AFDNPLGLNEVYTVASPFIASCPSSNGALPVKAFPALTMSSMDAVMTGSEVQLVAGSGF
FT                   DTSVSGIHAAFITVTGPVWTPLKSMGGGKFTVTIPEGISGQSYVVLTQGNKQATDDNIV
FT                   AGPAIVEVN"
     atgaagttga ccaacattgc cctcaccagt gctgccatcg gtcttgccaa cgccggcctt        60
     gtctcaaagc gcgctgtcag cgacgccgat atccttaact atgctcttac tcttgagcat       120
     ctcgaggcct ctttctatga ggagggtctt aagaacttca cccaggagga tttcgtcaag       180
     gctggcatga aggatccttt ctatgccaac ctaaaggaag ttgcttccga tgagaaggaa       240
     cacgtggatt tcctgacctc cgcgctcaag ggcatgtccc tctgcaccta caacttccca       300
     tctgccgacg tcaacggctt cctggccctc gccagtgtcc ttgagggtgt cggagtcagc       360
     gcctacctcg gagccgcagc ctctatcatg agcgagaact acctgacagc ggctggcagc       420
     atcctcacca cagaagcccg acacagcgcg tacctgcgcg ccgcggtcgg cgaagtcccc       480
     ttcgcccagg ccttcgacaa ccctctcggg ctcaacgaag tatacaccgt tgcatccccc       540
     tttatcgcct cctgtccctc cagcaacggt gcactgccag tgaaggcctt ccccgcactc       600
     acgatgagtt cgatggacgc cgtcatgaca ggctcggagg tgcaactggt agccggtagc       660
     gggttcgaca caagcgttag cggtattcac gccgccttta ttaccgtcac cggcccagtc       720
     tggactcccc tcaagtctat gggtggtgga aagttcaccg tcactatccc cgagggcatt       780
     tccgggcaga gctacgtcgt cctgacccag ggcaacaagc aggcgactga tgacaatatt       840
     gttgctggtc ctgctatcgt cgaggtaaat tag                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page