(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE470

PENCW_13.PE470       Location/Qualifiers
FT   CDS_pept        join(complement(1101416..1101744),
FT                   complement(1100854..1101277),complement(1099963..1100808))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824616"
FT                   /orf_name="Pc16g04700"
FT                   /product="Pc16g04700 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP93140.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000183189A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H900"
FT                   /transl_table=1
FT                   /translation="MVERTEHDYRNSGEIEPHRNGDEIAALEKQSTAASGYSAFEQRTQ
FT                   SIVSRIRSREPGQTAKFHHPLTHTKTSPDVIVDFDGPDDPYRPLNWGFKKKAVTTVLYG
FT                   LTTMGIYSTGQIQISQEFGISNEVATLGTSLLLFGLGLGPLIWAPLSELYGRKTAVLPP
FT                   YFLAAIFSFATATAKDVQTIMITRFFTGFFGSAPVTNTGGVLSDIWSPEERGAAIVGYA
FT                   MAVVGGPVIGPIAGGAIVQSNLGWRWTEYITGIMMMFFLIMDLLFVDESYPPVLLVYKA
FT                   RRLRFESGNWALHARHEEWDVTLKEIGNKYLVRPFQLLATPICFLVALYASFVYGILYL
FT                   SLAAFPIVFQELRGWNQVVGALPFLAYLVGILIGGGINLANQKFYIKRFKANNNRPVPE
FT                   ARLPPMMIGSVLFASGMFVFGWTSPKHIHWICPNIGAVMMGLGFFTIFQAALNYLIDTF
FT                   QKYSASAIAANTFLRSMFAGCFPLFTAAMFHNLGVPWAASVLGFISVALIPIPYLFYKF
FT                   GKRIRARGTWSRDSV"
     atggtcgaac ggacagaaca tgactatcgc aattccggag agattgaacc gcatcgcaac        60
     ggggatgaaa tcgcagcctt ggaaaagcaa agtaccgcgg catcgggcta ttcggccttt       120
     gaacagcgca cgcagtcaat agtctcgcgc attcggagtc gagagcccgg ccagacggcc       180
     aaattccatc atccactcac ccacaccaag acaagtcccg atgtcattgt cgattttgat       240
     gggccggatg atccttacag gccgttgaac tggggtttca agaagaaggc tgtcacgacg       300
     gtgttgtatg gattaactac tatgggtatc tactccactg gtcagataca gattagccag       360
     gagttcggca tctcgaatga ggtcgctaca ctcggcacct cgttactttt gttcggcttg       420
     ggattgggcc cgttgatctg ggcacctctg tctgagctct atggacgcaa aacggcagtt       480
     ctaccgccat actttctcgc ggcgatcttt tccttcgcaa cagccaccgc aaaagacgtc       540
     cagactatta tgatcactag attctttacg ggctttttcg gctcggcacc tgttaccaac       600
     accggcggag tcctaagtga tatctggagc cccgaagagc gtggtgccgc cattgtcggc       660
     tatgccatgg ccgtagtggg cgggcctgtc atcgggccta tcgcgggtgg tgccatcgtg       720
     cagagcaatc taggctggcg ctggactgaa tatatcaccg gtatcatgat gatgttcttc       780
     ctaatcatgg acctcctctt cgtcgatgag agctacccac cagttctgct ggtctacaag       840
     gcccgtcgac tccgcttcga gagcggcaac tgggccctcc atgcacgcca cgaggaatgg       900
     gacgtgactc tcaaagaaat aggcaacaag tacctcgtcc gtcccttcca actcctcgca       960
     accccaatct gcttcctcgt cgccctctac gcatccttcg tctacggcat cctctatctc      1020
     agtctagcag ccttcccaat cgtcttccag gaactccgcg gctggaacca agtcgtcggc      1080
     gccctccctt tcctcgcata cctagtcgga atcctaatag gcggaggtat caacctcgcc      1140
     aaccagaaat tctacataaa gcgcttcaaa gcgaacaaca accgccccgt cccagaagcc      1200
     cgtcttccgc ccatgatgat cggatctgtc ctcttcgcaa gtgggatgtt cgtcttcggc      1260
     tggacaagcc caaaacacat ccattggatc tgtccgaata tcggtgcggt catgatgggc      1320
     ttaggctttt tcaccatctt ccaagctgct ctcaactacc tcattgatac attccagaaa      1380
     tactctgcta gcgcgatcgc ggcaaatact ttcctgcgct cgatgttcgc gggctgtttc      1440
     ccgctcttca cggctgccat gttccataat cttggtgttc cgtgggctgc tagcgtgctg      1500
     ggcttcattt ctgttgctct cattcccatt ccatatttgt tctataagtt cgggaagcgg      1560
     attcgagcac gcgggacgtg gtcgcgagac tcggtttaa                             1599
//

If you have problems or comments...

PBIL Back to PBIL home page