(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE471

PENCW_13.PE471       Location/Qualifiers
FT   CDS_pept        join(complement(1104725..1104800),
FT                   complement(1104632..1104649),complement(1104489..1104565),
FT                   complement(1104350..1104416),complement(1103272..1104299),
FT                   complement(1102388..1103221))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076674" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671908"
FT                   /orf_name="Pc16g04710"
FT                   /product="Pc16g04710 protein"
FT                   /protein_id="CAP93141.1"
FT                   /db_xref="InterPro:IPR019412"
FT                   /db_xref="UniParc:UPI000183189B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H901"
FT                   /transl_table=1
FT                   /translation="MLRVGSWLYGKKPAQSVDSQVELKDLHDAMTAATLILNDDVDGAE
FT                   NGLSTGTSSFHNLGKGVVAFVRATLGFEQEIMRQASERLYEAETSAASDQTRSQQNAQA
FT                   PNAFHSDIYAAGTEYALCQAIAQLMNAVVGVLNESLTESIKAFYRLRKAYIALDAIMKM
FT                   EEKFMEQRDIHKGILPTTSDLSCSESSSLSSKKGTKGATVDQTELSSSMNGLAISSRGA
FT                   SPDASTGTSTPAKHIHHDPDSDIFKNEIDVFVHSGANFCFGILLLLISMVPPAFSKLLS
FT                   IIGFHGDKQRGLKMLWQASKFHNLIGAMAALALLGYYNGFVRYCDIMPDPTPGEADVEG
FT                   YPQERLAALLAEMRSRFPNSQLWLLEESRMLGANKDLDSALDLLSTGKRSPLKQVEGLC
FT                   VFEKGLNALFLHRYDVCAEVFIECVDLNSWSRSLYYYIAGACHVVQYRQSLNDPKLAEE
FT                   HAKKATLYLRKAPEFAGKKKFMARQLPFDIFVTRKLAKWEARAKEWNVSLVDAIGVDPV
FT                   EEMIFFWNGHSRMTNEQLQESLTRLEWCESENNKTWSREGIEEKAILELLRAAVLRSLY
FT                   RHDEAKKILQTRVLNHDKSVFKGHLKDDWVHPAAHFEMAANFWMERPAYQVLHGIASPK
FT                   VSNEASAESGETNTESERKQVSECKEYLEHAARWESYELDARIGLKVTAAMEAVHKWEN
FT                   MHPTV"
     atgttacgag tcgggtcctg gttgtacggc aagaagccgg cacagtctgt ggactcgcag        60
     gttgagttga aggacttgca tgatgcgatg acagcggcga cgctgattct caacgatgat       120
     gttgatgggg ccgagaatgg tctctccacg ggcacttcgt cttttcacaa cctgggtaaa       180
     ggcgtggtcg cattcgtccg ggcaacatta ggcttcgagc aggagattat gcgacaagca       240
     tccgaacgtc tttatgaagc agaaaccagc gcggccagcg accaaacccg gtcccagcaa       300
     aacgcccaag cgcccaatgc cttccactcc gatatctatg ctgccggtac cgaatatgcc       360
     ttgtgtcaag caatcgcgca attgatgaat gcggttgttg gggtgctgaa tgagagcctg       420
     actgaaagta tcaaagcatt ctatcggctg agaaaggcgt atatcgcact ggacgctatc       480
     atgaagatgg aagagaagtt tatggagcag agggatattc ataagggcat actgcccact       540
     acgagtgacc tgtcatgctc ggaatcgtcc agtctgtctt ctaaaaaggg cacaaaaggg       600
     gctaccgtcg accaaaccga gctcagttca tcaatgaatg gacttgcgat ctcgtcccga       660
     ggggcgtctc cagatgcctc aaccggtact tccacacccg cgaagcatat ccaccacgac       720
     cctgactcgg acatcttcaa aaacgaaatc gatgtctttg tgcactctgg tgccaatttc       780
     tgttttggta tccttcttct actgatctct atggttccac cggcatttag caagcttctt       840
     tccattatcg gcttccacgg cgacaagcaa cgcgggctga aaatgctctg gcaagccagc       900
     aagttccaca acctcatcgg tgccatggct gctcttgcac tgctggggta ttacaatggc       960
     tttgtccgct actgcgatat tatgcccgac ccaactcctg gcgaagccga cgtcgaggga      1020
     tatccacagg agaggctggc tgcgttgctg gcggagatgc ggtctcggtt ccccaacagt      1080
     cagctttggc tgcttgaaga atcacggatg ttaggtgcga acaaggacct ggacagcgct      1140
     ctggatctat tgtccacggg caaaaggagc ccgctcaagc aggtcgaggg attgtgcgta      1200
     ttcgaaaagg gcctgaacgc actgtttctc cacagatatg atgtctgtgc tgaagtattc      1260
     atcgagtgcg tggaccttaa ttcgtggtct cgttcgttgt attactacat cgctggagcg      1320
     tgccacgttg tccagtaccg gcaatcactc aacgatccaa agcttgcaga ggaacatgct      1380
     aagaaagcca cactgtacct gcggaaggcc ccggaattcg ctgggaaaaa gaaattcatg      1440
     gcccgacagc tgccgtttga tatctttgtg actcggaaac ttgccaaatg ggaagcgcgc      1500
     gctaaggaat ggaacgtatc tctggtagat gcgattggag tggatcctgt cgaagaaatg      1560
     atcttcttct ggaacggaca cagtcgcatg accaacgagc agctgcaaga gtccctgacc      1620
     cggctggaat ggtgcgagag cgagaacaac aagacctggt ctcgcgaggg catcgaagaa      1680
     aaggccatcc tggagcttct ccgggctgcc gtcttacgat ccctgtaccg acatgatgaa      1740
     gcgaaaaaga tcctgcagac ccgcgtcttg aaccacgaca agtctgtatt caagggtcac      1800
     ctgaaggatg actgggtcca cccagcggca catttcgaga tggcggccaa cttctggatg      1860
     gagcgtcccg cataccaggt cctgcatggg attgcctccc ccaaggtgtc gaacgaagcg      1920
     tccgcggaat ctggggagac gaacacggag agcgagagaa agcaggtatc cgagtgcaag      1980
     gaatacctcg aacatgctgc tcgctgggag agttacgagc tggacgctcg tattggactc      2040
     aaggttactg cggccatgga agccgttcac aagtgggaga acatgcaccc gacagtctaa      2100
//

If you have problems or comments...

PBIL Back to PBIL home page