(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE472

PENCW_13.PE472       Location/Qualifiers
FT   CDS_pept        join(1105448..1105556,1105617..1105741)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207862" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948787"
FT                   /orf_name="Pc16g04720"
FT                   /product="Pc16g04720 protein"
FT                   /protein_id="CAP93142.1"
FT                   /db_xref="InterPro:IPR007834"
FT                   /db_xref="UniParc:UPI000183189C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H902"
FT                   /transl_table=1
FT                   /translation="MSNPTTQKADAPEQAPPQAKPQVLEEDDEFEDFPVEDWPQEEAEQ
FT                   TNGSKANDGSEHLWEESWDDDDAAEDFSKQLK"
     atgtcaaacc caactaccca gaaggctgat gccccagagc aagccccgcc ccaagcgaaa        60
     ccccaagtct tggaggaaga cgacgagttc gaggatttcc ccgttgaaga ctggccccaa       120
     gaagaagccg agcagaccaa cggctcgaaa gcaaacgacg gtagcgagca cctgtgggaa       180
     gagagctggg atgacgatga tgcggcagag gacttctcaa agcagctgaa gtga             234
//

If you have problems or comments...

PBIL Back to PBIL home page