(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE473

PENCW_13.PE473       Location/Qualifiers
FT   CDS_pept        join(complement(1107942..1108007),
FT                   complement(1107466..1107886),complement(1106637..1107403))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000227107" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128960"
FT                   /gene_name="pgkA"
FT                   /orf_name="Pc16g04730"
FT                   /product="Phosphoglycerate kinase pgkA-Penicillium
FT                   chrysogenum"
FT                   /function="phosphoglycerate kinase activity"
FT                   /biological_process="glycolysis"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP93143.1"
FT                   /db_xref="GO:0004618"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015901"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="UniParc:UPI000183189D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H903"
FT                   /transl_table=1
FT                   /translation="MSLSNKLPVTDVDLKGKRVLIRVDFNVPLDENKNVTNPQRIVGAL
FT                   PTIKYAIDNGAKAVVLMSHLGRPDGKVNPKYSLKPVVPVLEELLGKSVTFTEDCVGPQT
FT                   EETVNKASDGQVILLENLRFHAEEEGSSKDAEGKKVKADKADVDAFRKGLTALGDVYVN
FT                   DAFGTAHRAHSSMVGVDLPQKAAGFLVKKELEYFAKALESPARPFLAILGGAKVSDKIQ
FT                   LIDNLLPKVNSLIITGGMAFTFKKTLENVKIGNSLFDEAGSKIVGEIVEKAKKHNVEIV
FT                   LPVDYVTADKFSADATVGAATDASGIPDGYMGLDVGPESVKLYQKTIAEAKTILWNGPP
FT                   GVFELKPFAKATEATLDAAVKAAESGSIVIIGGGDTATVAAKYKAEDKISHVSTGGGAS
FT                   LELLEGKELPGVAALSSK"
     atgtctctct ccaacaagct ccccgttact gatgtcgacc tcaagggcaa gcgtgtcttg        60
     atccgggttg acttcaatgt ccccctcgat gagaacaaga acgttaccaa cccccagcgt       120
     atcgtcggtg ccctgcccac catcaagtat gccatcgaca acggtgccaa ggccgttgtg       180
     ctcatgtccc acctgggtcg ccccgatggc aaggtcaacc ccaagtacag cttgaagccc       240
     gttgttcccg tgcttgagga gctcctcggc aagagcgtca ctttcaccga ggactgcgtt       300
     ggcccccaga ccgaggagac cgtgaacaag gcttccgatg gccaggtcat tctgctcgag       360
     aacctgcgtt tccacgccga ggaggagggc agctccaagg atgccgaggg caagaaggtc       420
     aaggccgaca aggccgatgt tgatgcgttc cgcaagggcc tcactgccct cggtgacgtt       480
     tacgtcaacg atgctttcgg taccgcacac cgcgctcaca gctccatggt cggcgtggac       540
     ctcccccaga aggctgccgg tttcctcgtg aagaaggagc tggagtactt cgccaaggct       600
     cttgagagcc ctgcccgccc cttcctcgcc atcctcggcg gtgctaaggt gtctgacaag       660
     atccagctga ttgacaacct cctgcccaag gtcaacagcc tcatcatcac cggcggcatg       720
     gccttcacct tcaagaagac tctcgagaac gtcaagatcg gcaacagtct cttcgacgag       780
     gccggcagca agatcgtcgg cgagatcgtc gagaaggcca agaagcacaa cgtcgagatc       840
     gttctccccg ttgactacgt caccgccgac aagttctccg ccgatgccac cgttggtgcc       900
     gccaccgacg ccagcggtat ccctgacggc tacatgggtc tggatgtcgg ccccgagagt       960
     gtcaagctct accagaagac catcgccgag gccaagacca tcctctggaa cggtccccct      1020
     ggtgtcttcg aactcaagcc tttcgccaag gccaccgagg ctaccctcga tgccgctgtc      1080
     aaggctgctg aatccggttc cattgtcatc attggtggtg gtgataccgc taccgtggcc      1140
     gccaagtaca aggccgagga caagatctcc cacgtctcga ccggtggcgg tgcctcgctc      1200
     gagcttctcg agggcaagga gctgcccggt gttgctgctc tgtccagtaa gtaa            1254
//

If you have problems or comments...

PBIL Back to PBIL home page