(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE474

PENCW_13.PE474       Location/Qualifiers
FT   CDS_pept        join(complement(1109614..1109671),
FT                   complement(1109529..1109554),complement(1109127..1109463),
FT                   complement(1108903..1109069),complement(1108778..1108849))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207873" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948788"
FT                   /orf_name="Pc16g04740"
FT                   /product="Pc16g04740 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP93144.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="UniParc:UPI000183189E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H950"
FT                   /transl_table=1
FT                   /translation="MAVAARLAAKFNTYYAERPVLTTMVTNAVLGGVADTVAQLITAFR
FT                   TRRPPTSGDDFLSIEIPDLDKQKPPAVGELGYVRSSSPPFDFERLTRFMAYGFFMAPVQ
FT                   FQWFGFLSRAFPLTKKNPTAPAFKRVAFDQFIFAPFGLACFFTYMTIAEGGGRRALTHK
FT                   FRDVYLPTLKANFVLWPAVQILNFRVIPIQFQIPFVSTVGIAWTAYLSLTNSAEEV"
     atggcagtag cagcacggct tgctgccaaa tttaatacct actatgctga aaggccagtg        60
     ctcacgacga tggtcaccaa cgctgtgctt ggtggtgttg ccgataccgt tgcgcagttg       120
     attacggcct tccggacccg ccgacctcca accagcggcg acgatttcct ttcgatcgag       180
     atccccgact tggacaagca gaagcccccc gctgtagggg aactgggata tgtccggagc       240
     tcgtccccac ctttcgattt tgagcgtctg acgaggttca tggcttacgg cttcttcatg       300
     gcgccggtgc agttccagtg gtttggattc ttgtctagag cattcccact caccaagaag       360
     aacccgacag ctccggcttt caagcgtgtt gcctttgacc agttcatttt tgcgccattt       420
     ggtctggcgt gcttcttcac ctacatgacg attgccgagg gtggtggtag aagggcattg       480
     acacacaagt tccgtgatgt ctacctgccc accctaaagg ccaacttcgt gctctggccg       540
     gcagtgcaga tcctaaactt ccgtgtcatt cccattcagt tccagattcc attcgtctca       600
     accgttggta ttgcgtggac cgcatacctt tccctgacta actccgccga ggaggtttaa       660
//

If you have problems or comments...

PBIL Back to PBIL home page