(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE475

PENCW_13.PE475       Location/Qualifiers
FT   CDS_pept        join(1110839..1110923,1111159..1111273,1111340..1111613)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948789"
FT                   /orf_name="Pc16g04750"
FT                   /product="Putative uncharacterized protein Pc16g04750 "
FT                   /protein_id="CAP93145.1"
FT                   /db_xref="UniParc:UPI000183189F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H951"
FT                   /transl_table=1
FT                   /translation="MDEWNAPPLLTTAALQGWSERKTMFRTSGSQKRNEAQIVAKLKMC
FT                   LADLYDGHDVIPAKPSCGRTLAMSLGEKYSGGTPEETADYLPEDQTKCKYSLAARRNEV
FT                   SNVLSSLLADSQLKQKHILDTQVQGYRQCHRGGHAGPLTVGRWLTSAHRLLQL"
     atggatgagt ggaatgctcc cccgttatta acaacggcgg cactccaggg ctggtctgag        60
     cgaaagacaa tgtttcggac atctggctcc cagaaaagaa acgaagcgca aatcgtggct       120
     aagctgaaga tgtgcctcgc tgatttatac gacggccacg atgttatccc tgccaaaccc       180
     agctgtggga gaacactggc aatgtcactc ggcgaaaaat actccggagg gactcctgaa       240
     gaaaccgctg actacttgcc agaggaccag acaaaatgta agtactcgct tgctgcaagg       300
     aggaacgaag tgtctaacgt actgtccagt ctcctggcgg atagtcagct caaacagaag       360
     catattttgg atactcaggt acaagggtat cgtcaatgtc atcgaggagg gcatgcaggg       420
     ccattgacag ttgggagatg gctcacttca gcacatcgcc tcttgcaact ctag             474
//

If you have problems or comments...

PBIL Back to PBIL home page