(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE476

PENCW_13.PE476       Location/Qualifiers
FT   CDS_pept        join(complement(1113905..1114079),
FT                   complement(1113576..1113848),complement(1112404..1113514),
FT                   complement(1112176..1112344))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207885" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948790"
FT                   /orf_name="Pc16g04760"
FT                   /product="Pc16g04760 protein"
FT                   /protein_id="CAP93146.1"
FT                   /db_xref="UniParc:UPI00018318A0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H952"
FT                   /transl_table=1
FT                   /translation="MPGLEIPGEFLRHAILDTFVPHSPALDIEGALSSSLENGADDLPS
FT                   VLSSIPQRSLLFFDEFLPVRIVLRLSDCSETILKHYLPRLEVKLDVFAVDPAESVGENL
FT                   TPTRDIIFSGIVSGDEDPLVVFNEFEGDEGSGNHVYLVWNIETILRRPRIRIQHPSLLF
FT                   IASTSLNPADARRQEDSEDDYLPSLVPASTNMLQSLSIDKSFNHKEPFLPASRLLRVVP
FT                   TTYNEDPIYNIQQHHGHPFRVVPAASARIRYSRLNSYTGTPMTVASLDFEVTPYLTCEV
FT                   AFDKANLHLSEGTIESLSETPGLALPITCRPRDDVTLMYKLTPEYGPETNPSSTALVSM
FT                   LDIALEAIILVDDECKPRISMQWRTNVDFSVALNPTFGGPSPALQRTNRPTSLSVSTQG
FT                   GVTPSNRSSLRERAYSVTDVGITISFSGPVRVQVGSVFSWDVFIVNRSNVPRKFALIAI
FT                   PKRKRVDPRGHVARPSSSSITSRKEDQVAEAVTDDNIVHARQKSVAGQEVELISLSTDI
FT                   RVGPLLPGTCHSTELKLLPLATGPLHLEAVRLVDVNTNETTDIRDLPDILADDQPRSS"
     atgcctggtc tggagatccc gggtgaattc ttgcgtcatg ccattctcga cacatttgtc        60
     cctcattctc cggcactcga cattgagggc gctctgagtt cgtctctaga gaacggagct       120
     gatgatctac cctctgtcct ctcgtcaatc cctcaacgat cactattatt cttcgatgaa       180
     tttttgcctg tccgtattgt cttgagactg tctgattgct cagaaacgat cctaaaacac       240
     tatctgccac gacttgaagt caagctcgat gtcttcgccg tcgatccagc ggaatcagtc       300
     ggtgagaatc ttacgccaac tcgtgatata atattctctg gaattgtcag tggagatgag       360
     gatcccctgg tggtcttcaa cgaattcgag ggcgacgaag gcagtgggaa ccatgtctat       420
     ttggtttgga acattgaaac tatactgcga cgtccccgta ttcgaattca acacccctca       480
     cttttattca ttgcctctac cagtctgaat ccagctgacg ctcgccgcca agaggattcg       540
     gaggatgatt atctcccttc actcgtgccc gcatcgacta atatgctgca atctctatcc       600
     atcgacaaat cattcaacca taaagagcct ttcctccctg cttccagact gttgagggtt       660
     gtaccgacga cgtataacga agacccgatc tacaatatcc agcaacacca cggtcatccc       720
     tttcgggttg tgcccgccgc aagtgcaagg attcggtact ctcggctgaa ctcctacact       780
     ggtacaccaa tgacagtggc cagtcttgac tttgaggtca ccccttatct gacttgcgag       840
     gtcgcctttg acaaggcgaa tcttcacctg tccgagggaa cgattgagtc tctgtctgag       900
     acgccggggc tggctctccc tattacttgc cgtccgcgag acgacgtgac cctcatgtac       960
     aaactcacac cggagtatgg cccagagacc aatccatcat ctaccgcgtt ggtcagcatg      1020
     ctggacatag ctctcgaggc aataattctt gtagatgacg agtgcaagcc acgtatttct      1080
     atgcagtgga gaacaaacgt cgatttctct gtcgccttaa acccgacctt tggggggccc      1140
     agtccagcgc tgcaaaggac caaccgccct accagtctgt ccgtgtcgac ccaagggggt      1200
     gtgacacctt caaatcgaag ctcattacga gaacgagcat actcggttac tgatgttggc      1260
     atcacaatct ccttttctgg acctgttcgt gtacaagttg gttctgtctt ctcttgggat      1320
     gttttcattg tcaatcgatc aaacgttcct cgcaagtttg ccttaattgc catcccaaag      1380
     cggaaacgtg tggacccacg agggcatgtt gccaggcctt cctcatcatc tattaccagc      1440
     cggaaagagg accaagtggc cgaggcggtg actgacgata acatcgtgca tgcgaggcaa      1500
     aagagtgtgg ctggtcagga agtggaactg atcagcttga gcacagacat tcgcgttggt      1560
     cctctgcttc caggaacttg ccactcgacc gaactgaaac tccttcctct ggccacaggc      1620
     ccacttcatt tggaggctgt ccggcttgta gatgtgaata cgaacgaaac gactgatatc      1680
     cgagatcttc cggacatttt ggcggatgat cagcctcgct ccagttaa                   1728
//

If you have problems or comments...

PBIL Back to PBIL home page