(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE477

PENCW_13.PE477       Location/Qualifiers
FT   CDS_pept        join(1114252..1114386,1114436..1114587,1114636..1114709,
FT                   1114782..1115752,1115812..1116798)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207896" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128961"
FT                   /orf_name="Pc16g04770"
FT                   /product="Pc16g04770 protein"
FT                   /protein_id="CAP93147.1"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR002713"
FT                   /db_xref="UniParc:UPI00018318A1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H953"
FT                   /transl_table=1
FT                   /translation="MDLSINPGAALWQQAQNAEGRVYYYNVQTKATQWTKPQELMTPVE
FT                   LALANQPWREHTTDAGRKYWYHTETKQSTWEMPEVYKNALAQAPAPLAPPATPSFVAGG
FT                   TSFPQPQQRDREDFDRGYGDRRGGYAPYEANGLVAAPEFKTMDPDYHSLEEAESAFMKL
FT                   LKRHNVQPDWTWEETMRATIKDPQYRALKDPRDRKAAFEKYVVEVRAQEKDRAKERFAK
FT                   LRADFNTMLKRHPEIKYYSRWKTIRPIIEGETTFRSTNEESERRQLFDEYILELKKAHL
FT                   EQESVTHKAAMDELMNILGSLNLEPYTRWSEAHAIIQSDSKFQGDDKFKTLSKSDILIA
FT                   FENHIKSLERAFNDARQQHKAARARKERKNREQFVALLKELRSQGKIKAGAKWMNICPI
FT                   IKDDPRYHGILGQSGSTPLDLFWDMVEEEERALRGPRNDVLDVLDDKRYEVTPETTFDE
FT                   FNSIMSADRRTSKIDPDILNLIFQRIQEKAIRRTEDEKHAADRQQRRAVDALRSRIKRL
FT                   EPPIRVTDTWAEVQPRLEKYDEYKALESDELRESAFEKAIRRLKERDEDAEREREALSQ
FT                   SRGGRRDFDRGDRDYRSGRGERRGHRTPEMDAYEADRRKAQADRERTYRKVSGISPSRD
FT                   RRDERGDRDRYRSRDRDFDRPRVRDPDRREDERERLYRTRGDPRGGRDELDYGGGTVGD
FT                   TRSVASGDRRRRRDSDTESVASRSAKRYRRDSRERERSKGPRAPRRERSAIPEEENEDA
FT                   KKDEKAIHSGSEEGEIEEE"
     atggatttaa gcatcaaccc aggtgctgcc ctatggcagc aggcgcaaaa tgctgaaggt        60
     cgcgtttatt attacaatgt ccagaccaaa gccacacaat ggaccaagcc tcaagagttg       120
     atgactccgg ttgagctcgc tctcgcaaac cagccatgga gggaacacac tacagatgct       180
     ggacgcaagt actggtacca cacagaaacc aagcaaagca catgggaaat gcctgaagtt       240
     tacaaaaatg cgcttgcaca ggcgcccgcc cccctggcac cccccgctac gccttccttt       300
     gtggcaggcg ggacctcttt cccgcaaccc cagcaacgtg accgtgaaga ctttgaccga       360
     ggatacggtg accgacgcgg tggatatgcg ccatatgaag cgaacggctt ggttgctgct       420
     ccggaattca agaccatgga tcccgactat cattctcttg aggaggctga gagcgccttc       480
     atgaagctgc tgaaacgcca caacgtgcag cccgattgga cttgggaaga aacaatgcgc       540
     gctacgatca aggacccgca ataccgggct ctcaaggatc cgcgagaccg caaggcagca       600
     ttcgagaaat acgtggtcga ggttcgcgcg caggaaaagg accgggccaa agaacgattc       660
     gccaagcttc gtgcggattt caacaccatg ctgaaacggc atcctgaaat taagtactac       720
     agccgctgga agacaattcg tccgatcatt gagggggaga ccacattcag gtctaccaat       780
     gaggaatccg agagacgtca gcttttcgac gagtacatcc ttgaactcaa gaaggctcac       840
     cttgagcaag aatctgtcac acacaaggcc gctatggatg agttgatgaa tatcctgggc       900
     tcacttaacc tggagccata cacgcgttgg tccgaggctc atgctatcat tcagtctgac       960
     agcaagttcc aaggtgatga caagttcaag accctgagca agtctgacat tctgattgcc      1020
     ttcgagaacc atatcaagtc cctggagcgg gctttcaacg atgctcgcca gcaacacaag      1080
     gcagccagag ccagaaaaga gcgtaagaac cgagagcaat ttgtggccct cctcaaggag      1140
     ctccgatccc aaggtaagat caaggcgggc gccaagtgga tgaatatctg cccgatcatt      1200
     aaggatgacc ccagatacca tggcatcctg ggccagtctg gttcgacccc tcttgacctg      1260
     ttctgggata tggtggaaga agaagagcgc gctttgcgcg gacctcggaa cgacgtgctg      1320
     gatgttctag atgacaaacg atacgaagtt acgcctgaaa cgacatttga tgaattcaat      1380
     tctatcatgt ctgctgaccg ccgcacctca aagatcgacc ctgacatcct caaccttatc      1440
     ttccagcgca tccaagaaaa ggcaatccgg cgcactgaag atgagaagca tgccgccgat      1500
     cgtcagcaac gccgtgccgt ggacgcactg cgttctcgta tcaagcgcct agaaccgccc      1560
     atccgggtca cggatacctg ggctgaagtc caacctcgcc ttgagaagta cgacgaatac      1620
     aaggcccttg agtccgatga acttcgggag tctgcctttg aaaaagcaat ccgccgcttg      1680
     aaagaaagag atgaggatgc agagagggag cgcgaggcac tctctcaaag ccgtggaggt      1740
     cggcgggact tcgatcgtgg tgatcgtgac taccgcagtg gaagaggaga acgacgagga      1800
     caccggaccc ctgaaatgga tgcatacgaa gcagaccgtc gtaaggccca ggccgaccgc      1860
     gaacgaacct accgcaaggt cagcggtatt tccccatctc gtgaccgtcg cgatgagcgt      1920
     ggagaccgtg accgttatcg tagccgggac cgtgactttg accgtccccg tgttagagac      1980
     ccagaccgac gtgaagacga acgcgagcgc ctgtaccgca ctcgtggcga tccccgtgga      2040
     ggtcgtgatg agcttgatta tggtggtggt actgtcggcg acactcgcag tgtggccagc      2100
     ggtgaccgcc gacgccgacg tgacagtgat actgagagtg tggctagccg gtctgctaag      2160
     cggtaccgac gtgatagccg ggagcgagag cgcagcaagg gtccgagagc cccccgacgg      2220
     gagcggtctg ccattccgga agaagaaaac gaggatgcga agaaggacga gaaggccatt      2280
     cactctggca gcgaggaagg agagattgaa gaggagtag                             2319
//

If you have problems or comments...

PBIL Back to PBIL home page