(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE478

PENCW_13.PE478       Location/Qualifiers
FT   CDS_pept        join(complement(1118677..1119224),
FT                   complement(1117553..1118618))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000237402" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128962"
FT                   /orf_name="Pc16g04780"
FT                   /product="Pc16g04780 protein"
FT                   /protein_id="CAP93148.1"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="UniParc:UPI000183196C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H954"
FT                   /transl_table=1
FT                   /translation="MSQPQFADRGTTQDTEAWIFGSGSEALASAVYLIKDAKVHPPKIH
FT                   IIDKHLFSERISHRPGSWSDGYDQFAACLPVPAGLPMERLLATLPSTQSQGPSLLEEIQ
FT                   TAEANRVPKKRDVRTCFLAMTKGSVNHIPTDSLNLSIKHRIALIQILFKRETYLSQRQV
FT                   QELLPENFFQSPFWTIWSAQFGFQPWHSAAEFRRSIRQYMPQFHSLSILSCLDITGYYQ
FT                   YESLYSPIYRFLESCGVDFRFGVEVKDIQVSKDDAKPKVTGFNLVKGKQQLRKQLGEND
FT                   IVIMNIGSTISGSAVGTNNSSPVWQSLDADDLFDQNWSVWLDLGNKHNGLGNPYNFCTR
FT                   QSETMVESFTITTQDLVLYDDLRSLIKCRSEAGAFIFLGDSNWKINLCIPAQPVFSSQP
FT                   EDVRVLWGFAHAPRVEGNYVNRILLHCSGADILSEILGHLNLHYNPPLSRTVTIPRAMP
FT                   RMSSLFITRALNDRPSITPLSNVGLVGPFTESSGYTCSDVSYGIRTAKTAVYKLMGLKG
FT                   ELDGPLYSNTSIIRKILFWR"
     atgtcccagc cacagtttgc ggaccggggt actacccagg ataccgaggc gtggatcttt        60
     ggaagcggaa gtgaagcatt agcttccgcg gtatatttaa tcaaagacgc caaagtacat       120
     ccaccaaaaa tccatatcat agacaagcac ctgttctcgg agcgaatatc gcaccgccca       180
     ggtagctggt ccgacggata cgaccaattc gccgcatgtc tgcctgttcc agctggctta       240
     ccgatggaaa gactcctcgc aactcttccc tcaacacaat cgcaagggcc gtctcttttg       300
     gaggagatac aaacggcaga ggcaaaccga gtccccaaga aaagagacgt tcgaacctgc       360
     tttctggcta tgaccaaggg ctcagtgaat cacataccca cagattcact aaatctgagc       420
     atcaagcatc ggatagcttt gatacaaatt ctcttcaagc gcgaaacata tctatcacag       480
     aggcaagtcc aggagcttct cccggagaac tttttccaaa gccctttctg gacaatctgg       540
     tctgcccaat ttggcttcca gccgtggcac agtgcagcgg agttcaggcg ctctattcgt       600
     caatatatgc ctcaattcca cagcttaagt attctaagct gcctcgacat cacagggtat       660
     tatcagtatg agtctttata ctcgccaatt tatcgttttc tcgaaagctg tggagttgac       720
     tttcgatttg gcgtcgaagt caaggatata caggtgtcta aagatgacgc taaaccaaaa       780
     gttacaggat tcaacctggt caaaggcaaa caacaactac gcaagcaact aggggagaac       840
     gatatcgtga ttatgaatat cggatccacc atctcaggtt cagcagttgg tacgaataat       900
     tcttcgccag tgtggcaatc actcgatgcg gacgatttgt tcgaccaaaa ttggtcagta       960
     tggctggacc ttggcaataa acataacggc cttggcaatc cgtacaactt ctgcacgcgc      1020
     cagtctgaaa ctatggtgga atccttcacg atcaccacgc aggatctagt tctctacgat      1080
     gacctcagat cacttataaa gtgcagatct gaggccggtg cattcatatt tctcggcgac      1140
     agcaattgga agataaatct gtgcataccc gcccagccgg tcttttcatc gcagccagaa      1200
     gatgtccgcg ttctttgggg gtttgcgcat gcccccagag tcgaaggaaa ttacgtgaat      1260
     cggattttgc tccactgttc cggtgcggat atattatctg agatactagg tcacctcaat      1320
     ctccactaca acccgccatt gtcccggact gtcaccattc cacgtgcgat gccccggatg      1380
     agttcattgt ttataacgag ggcattgaat gaccgtccat caattacgcc cctatccaat      1440
     gtaggtcttg tggggccgtt tacagagtcc tcgggttata catgctcaga cgtcagttac      1500
     ggcatccgca ctgccaaaac ggcagtctac aagctaatgg gtctgaaagg agagttagat      1560
     ggtcctttat attcgaacac ctcgattatc agaaaaattc tcttttggag gtga            1614
//

If you have problems or comments...

PBIL Back to PBIL home page