(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE48

PENCW_13.PE48        Location/Qualifiers
FT   CDS_pept        join(complement(105319..105400),complement(104779..104981))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671091"
FT                   /orf_name="Pc16g00480"
FT                   /product="Pc16g00480 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92718.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="UniParc:UPI0001831158"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U7"
FT                   /transl_table=1
FT                   /translation="MWDLEICTLGLDKSRSTGAVTALGPWFARQTVVHRSSLVKVRSDT
FT                   DLALFPPLGYGLQTAAGAILNTLNMQAGKTVAIFGLVGMSVPYWIKPGT"
     atgtgggatc tcgaaatatg tacactaggc cttgacaagt cccgcagcac cggtgctgtc        60
     acagcactag gcccttggtt cgcacgtcaa acagttgtac acagatcaag tctggtcaaa       120
     gtgcgatctg acaccgatct tgctttgttt ccgccactag gatacggact acagactgcg       180
     gcaggagcca ttctgaatac cctcaatatg caggccggaa agacagtagc aatattcggc       240
     ttagtaggga tgagcgttcc ttattggatt aagccaggca cttga                       285
//

If you have problems or comments...

PBIL Back to PBIL home page