(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE481

PENCW_13.PE481       Location/Qualifiers
FT   CDS_pept        join(1125832..1130174,1130231..1130354)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207917" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948791"
FT                   /orf_name="Pc16g04810"
FT                   /product="Pc16g04810 protein"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="chromatin binding"
FT                   /function="helicase activity"
FT                   /biological_process="chromatin assembly or disassembly "
FT                   /cellular_component="chromatin"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP93151.1"
FT                   /db_xref="GO:0000785"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003682"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006333"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="UniParc:UPI000183196F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H992"
FT                   /transl_table=1
FT                   /translation="MSNGYPISPVADDTHTDGDVVTQRERSPSEPVESHPVSESSPEPD
FT                   VADESYDGASADSDAEDEDAADDNSDYDANTYSRENSSSPHPVRGAKRKSSPVSETDLI
FT                   RQNPDLYGLRRSGRARTTRPVADSSDSDSDDVAPRTKRRRKDPSQQPSKASRSATVSSL
FT                   SESDSDEYGGKSARASKARRRRLQQTASYEPSLNEVRFSTRTAKKVSNYNEDDEEDEAM
FT                   FEDDPEDLAPNYWVESYVEDTRPAVDVVLNHRLKEGIDPKANDLGRNDFEFCIKWQDKS
FT                   HYHATWESNESIANFRSTRRVDNYVRKVLNEDIRLQYSVDAPPEDREKWNLDRERDVEA
FT                   IEDYKKVERVIGVRDGEDGTTEYLVKWKRLFYDSCTWEPEDLVSEIAQREIDRFLDRTA
FT                   RQPISDKNEMNVATRKSFEPIHGTPSFLQNGELKDFQVKGLNFLAFNWVRGRNVVLADE
FT                   MGLGKTVQTVSFINWMRHVRRQQGPFIVIVPLSTMPAWADTFDHWTPDLNYVVYNGSEK
FT                   ARSVLRDYELMVDGNPKRPKFHVLLTTYEYAMNDSPFLGQFKWQFMAVDEAHRLKNRDS
FT                   QLYIKLFEWKCQARLLITGTPIQNNLAELSALMDFLNPGLVEVDVDMDLNSEVASQKLA
FT                   ELTTAIQPYMLRRTKSKVESDLPPKTEKIIRVELSDVQLEYYKNILTKNYAALNDGNKG
FT                   MKQSLLNIMMELKKASNHPFMFPNAEAKILEGSARREDILRAMITSSGKMMLLDQLLRK
FT                   LSVDGHRVLIFCQMVGMLNILSEYMEYRGYKYQRLDGTIPSAARRLAIEHYNAPGSTDF
FT                   AFLLSTRAGGLGINLMTADTVVLFDSDWNPQADLQAMARAHRIGQTRPVSVYRLVSKDT
FT                   IEEEVIERARNKLLLEFITIQRGVTDKEASEMQNKMARVVAEPNSTDDISRILKRRGQK
FT                   MFEQTDNQKKLEQLDIDSVLANAELHQTEEAEQIQADGGEEFLKAFDFVDIKVDDLTWD
FT                   DIIPKEQLEVIKAEEKRKDDDRYLAEVVEQNRPRKRHAPTDTTDSREERKAKRLARAQV
FT                   NIDDGEEESASLDPKRPLGEKEYRALSRAFLRYGDMDDSEDLILEDARLQNRDRGTVRD
FT                   ALHEITDKANALVQESLDQLEAMKQSGRNPTKKEQKAVLFDHHGVKRLNAWTIVERPPD
FT                   MRLIRSIIKALTDFKTFRLPEATKLADYSCQWGAREDGMLLVGIARHGFGAWTQIRDDT
FT                   ELGLGDKFFLEEHRVERKTQRLQTEEKATKSPGAVHLVRRAEYLMSVLRNKYNNNATAR
FT                   RAVDNHHRNNKRGSRVSGSGSVSASPAPSSSRRPENPRKGHRESDRSRPRPRDVDRHNT
FT                   PSHDSRSRSSLDDRPRHRLSDASNDELRRRKGHENGSSNKEDMAFMFFKPIVANLKQVS
FT                   MITAKNYPSKNERAQKLRLTLVKIGEFIRNNLEGSQSMPSLEVRLWDYVSLNYWPNKDA
FT                   SGAKLQQMFNKVMEASKASKASNGSSA"
     atgtctaatg gctaccctat ttcgccggtc gctgacgata cccacacgga tggcgacgtg        60
     gtaacgcaac gtgagcgcag tccgtccgag cccgtggagt ctcaccccgt ctccgagtcc       120
     tcccccgaac ccgatgttgc ggacgagtca tatgacggcg cgtctgccga ttcagatgcg       180
     gaagatgagg acgcagcgga cgacaacagc gattacgacg ccaatacata cagccgtgaa       240
     aactcttcat cccctcatcc cgtccgcggt gcgaagcgca aatcgtcacc ggttagcgaa       300
     accgacctga tcagacaaaa tcccgatctt tacgggcttc gacgaagtgg tcgtgctcgc       360
     acaacgcgcc ctgtcgccga ctcatctgac tcagactcag atgatgttgc accacgtact       420
     aaacgtcgtc gcaaagatcc atcccaacaa ccatctaaag cctcgcgatc cgctactgtg       480
     tcttccctat ctgagtccga cagtgatgag tatggcggaa agagtgctcg tgctagcaag       540
     gcgagaaggc gacgtctcca acaaactgct agttatgagc cctcattgaa cgaggtccgc       600
     ttctcaacac gaaccgccaa gaaggtgtca aactacaacg aggatgatga ggaagacgaa       660
     gccatgtttg aagatgatcc tgaagatctt gcgccgaact actgggtgga gagttatgta       720
     gaggacactc gccccgctgt cgacgtcgtc ctgaatcacc gcctcaagga gggcatcgac       780
     ccaaaagcca atgatctcgg ccgcaacgac tttgagtttt gtatcaagtg gcaggacaaa       840
     tcacactatc atgctacgtg ggaaagcaat gaatcgatag ccaatttccg cagcacgcga       900
     cgcgtggata attatgttcg gaaagtgctc aatgaggata ttcggttgca atacagtgtc       960
     gatgcccctc ctgaagatcg cgaaaaatgg aacctcgatc gcgagcgaga cgtcgaggcc      1020
     atagaggatt acaaaaaggt tgaacgagtc attggtgtac gtgatggcga ggatggtacc      1080
     acggaatacc ttgtaaaatg gaagcgtctc ttctacgatt cctgtacttg ggaaccagag      1140
     gacctggtta gtgagatcgc tcaacgtgag attgaccgat tcttggaccg caccgctcga      1200
     caacccatct ccgacaagaa cgagatgaat gttgccacgc gtaaatcctt cgagcccatt      1260
     catggaactc ctagtttctt gcagaatgga gaactcaagg acttccaagt caagggtcta      1320
     aacttcttgg ctttcaattg ggtcaggggt cgcaatgtgg ttttggctga tgagatgggt      1380
     ctcggaaaga cagtacaaac tgtctccttc atcaactgga tgcgccatgt caggcgacag      1440
     caagggccat ttatcgtcat cgtccctcta tctacaatgc cagcatgggc tgataccttt      1500
     gaccactgga caccggacct gaactacgtt gtttacaatg gtagtgaaaa ggcacgctcc      1560
     gttttgcgcg attatgaatt gatggtcgat gggaatccca aacgtccaaa gttccacgtt      1620
     ctcttgacaa cctacgagta tgcaatgaat gattcaccgt tcctcggcca attcaagtgg      1680
     caatttatgg cagtggatga ggcccaccgt ctcaagaatc gcgattcaca attgtatatc      1740
     aagttgttcg aatggaaatg ccaggcacgc ctcttgatta ctggtacccc aatccaaaac      1800
     aaccttgccg agctttcagc actaatggat ttcctcaacc cgggccttgt tgaagtcgac      1860
     gtcgacatgg acttgaattc tgaggtagca tctcaaaaac ttgcggaatt gactactgct      1920
     atccagccct acatgttgcg gcgtaccaag tccaaggttg agtcggatct tcctccgaaa      1980
     actgagaaga tcattcgagt cgagctttcc gatgtccaat tggaatacta caagaacatc      2040
     ttaacgaaaa actacgctgc actgaacgat gggaacaagg gtatgaagca gtctctcctg      2100
     aacatcatga tggaattgaa aaaggccagc aaccacccgt ttatgttccc caatgcagaa      2160
     gcaaagattc tggaaggcag tgctcgtcga gaagacatcc ttcgagccat gatcaccagc      2220
     agtggaaaga tgatgcttct cgatcaactc ctccgcaagt tgagcgttga tggccatcga      2280
     gttttgatct tctgtcagat ggttggcatg cttaacatcc tgagtgagta tatggagtac      2340
     cgtggttaca agtatcaacg acttgatgga actatcccgt ctgccgcccg tcgcttggca      2400
     attgagcatt acaatgctcc tggtagcacc gactttgcat tccttctttc aacccgtgca      2460
     ggtggtctcg gtatcaacct tatgactgcg gacactgtcg ttctgtttga ttcggattgg      2520
     aacccccagg cggatttgca ggctatggcg cgtgctcatc gaatcggtca aacaagacct      2580
     gtcagtgttt accgccttgt ctcaaaggat acgattgaag aagaagtcat cgaaagagct      2640
     cgcaacaagc tcttgctcga gttcatcacc atccagcgtg gtgtcacaga caaagaagcc      2700
     tcggagatgc aaaataagat ggcccgcgtg gttgccgagc ctaactccac agacgatatc      2760
     tctcggatcc tcaagcgccg cggtcagaag atgttcgaac agaccgacaa ccagaagaaa      2820
     ctggagcagc ttgatatcga ttccgtcctt gcaaacgctg aattacacca aaccgaagag      2880
     gctgagcaaa tccaagccga cggtggcgag gaatttttga aagcgttcga ctttgtcgac      2940
     atcaaagttg acgatctcac ctgggacgac atcattccaa aggaacagct cgaagtgatc      3000
     aaggccgagg aaaagcgcaa agatgatgac cgttatctag ctgaggtcgt tgagcaaaat      3060
     cgaccccgca agcgccatgc tcccacggac actacagatt cacgagagga gcgcaaggcg      3120
     aaacgactcg cacgagctca agtcaatatc gatgatggag aggaagagag tgcctccttg      3180
     gatcctaagc gccccctggg agaaaaagaa taccgtgcgc tttctcgagc tttcctgcgc      3240
     tacggcgata tggatgactc cgaagacctc atcctcgagg atgccaggct acaaaatcgc      3300
     gatcgaggca ccgttcgtga tgctcttcat gaaattaccg acaaggcaaa cgcgcttgtc      3360
     caagagagtc tggatcaatt agaggccatg aaacaatcgg gtaggaaccc caccaagaaa      3420
     gagcagaagg ccgtcttgtt cgatcatcac ggtgtcaagc gactcaatgc atggactatc      3480
     gttgagcgtc cacccgatat gcgccttatc cgaagcatca ttaaagcatt gactgatttc      3540
     aagacattcc ggcttcctga ggctaccaaa ttagcggact atagctgcca gtggggtgcg      3600
     cgcgaagacg ggatgcttct tgtgggtatc gcacgccatg ggtttggtgc atggactcag      3660
     attcgtgacg acactgagct tggcctcggc gacaaattct tcctcgagga acaccgagtg      3720
     gagcgcaaga cgcaacgcct acagaccgag gagaaggcaa cgaaatcacc gggtgctgtc      3780
     caccttgtcc gacgagctga atacctcatg tctgttctga gaaacaagta caataacaac      3840
     gctacagcaa gaagggcagt tgacaatcac catcgcaaca acaagcgtgg ctcacgggtt      3900
     tcgggtagtg gcagtgtctc cgcctcccca gcgccctcga gctctcgcag gcctgagaat      3960
     ccccgcaagg gccatcgtga gtctgatcga tcacggcccc gcccccggga tgtggaccgt      4020
     cataatactc ccagccatga ctctcgttca cggtctagtc ttgatgatcg tccacgtcat      4080
     cgtctatccg atgcctctaa cgatgaactt cgtcgccgca aaggtcatga gaacggcagt      4140
     tctaataaag aagacatggc cttcatgttc ttcaagccta tcgttgccaa tttgaagcaa      4200
     gtgtcaatga tcactgccaa aaattaccca agcaaaaacg agcgggccca gaaactccgg      4260
     cttactcttg tgaagattgg agaattcatt cgcaataatc tggagggctc gcaatcgatg      4320
     ccctccttgg aggtccgact ctgggattac gtttcactca actactggcc aaacaaagat      4380
     gccagtggtg ctaagctgca gcagatgttc aataaggtca tggaagccag caaagcttcc      4440
     aaggcctcta atggcagctc agcttga                                          4467
//

If you have problems or comments...

PBIL Back to PBIL home page