(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE483

PENCW_13.PE483       Location/Qualifiers
FT   CDS_pept        join(complement(1134691..1134742),
FT                   complement(1134206..1134638),complement(1133651..1134131))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000250284" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948792"
FT                   /orf_name="Pc16g04830"
FT                   /product="Pc16g04830 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP93153.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI0001831971"
FT                   /db_xref="UniProtKB/TrEMBL:B6H994"
FT                   /transl_table=1
FT                   /translation="MPSLIGKEIGPIGYGTMRMTWNAQPPSEEVCFETLNTTLELGANF
FT                   WNGGELYGTPEYNSLHLLNKYFTKYPGNADKVVLSVKGGLKKGELTPDGSEENIRRSVD
FT                   ECLRLLDGKKKLDIFECARQDPAFPVEQTIKVLAEYVKEGKIGGIGLSEVDAETIRRAH
FT                   KVHPIAAVEIEMSLWSTDILHNDIAKTCAELQIPVIAYSPLGRGVLTGAVTSLADIPAG
FT                   DIRHHLSRFQEENFKHNMKLINEVNDLATRKGVASAQIALAWILTQSKKPGMPTIIPIP
FT                   GGTTKDKVVQNMGGAQALTDSEMAEIEAILEEHTVSGARY"
     atgccttctc taattggaaa ggaaatcggc cccattggct atggcacgat gagaatgacc        60
     tggaacgcgc agcctccctc agaggaggtg tgctttgaga cactgaacac taccctggaa       120
     ctcggtgcca acttctggaa cgggggcgag ctatatggca ctccggagta caactctctg       180
     catctcctca acaagtactt caccaagtac cccgggaacg cagacaaggt cgttcttagt       240
     gtcaaaggtg gcttgaagaa gggcgagctt accccggatg gctcggaaga gaacatccgt       300
     cgtagcgtgg acgaatgtct gcgtctgctc gatggcaaga agaaacttga tattttcgaa       360
     tgtgcgcgac aagaccctgc tttccccgtt gagcagacca tcaaggtact cgcagagtat       420
     gtcaaggagg gcaagattgg aggaattgga ttgagcgagg ttgatgccga gacaatccgc       480
     cgagcacaca aggtacatcc aattgctgct gtcgagattg aaatgtcctt gtggtctacc       540
     gatatcctcc acaatgacat tgccaaaacc tgtgcggagc tgcagatccc tgttatcgct       600
     tactcgccac ttggtcgagg tgtcttgacc ggagctgtga cctcgctggc cgatatcccc       660
     gctggtgata tccggcacca tttgtcccgt ttccaggaag agaacttcaa acacaacatg       720
     aagctcatca atgaggtcaa tgaccttgct actcgtaagg gtgttgcctc tgctcagatt       780
     gcactggcat ggatccttac ccagagtaag aagcctggca tgcctactat tattcccatt       840
     cctggcggta ctacgaagga caaggtggtc cagaacatgg gcggtgcaca ggcgctgacg       900
     gattccgaga tggctgagat cgaggctatt ttggaggaac acacggtttc tggggctcgg       960
     tactag                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page