(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE484

PENCW_13.PE484       Location/Qualifiers
FT   CDS_pept        join(complement(1135984..1136127),
FT                   complement(1135480..1135923))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671910"
FT                   /orf_name="Pc16g04840"
FT                   /product="Putative uncharacterized protein Pc16g04840 "
FT                   /protein_id="CAP93154.1"
FT                   /db_xref="UniParc:UPI0001831972"
FT                   /db_xref="UniProtKB/TrEMBL:B6H995"
FT                   /transl_table=1
FT                   /translation="MSHVTSRASWLSLLLVSLLVVSTVNALPIYQTDQQIEGQVGKLES
FT                   RSPRLIPDTAEYVHDILQGLGLTKPSPSSTATSSATPTSTPTSTPTASIKDEQDVEYMK
FT                   PTHTTHIIYSSSTSYTPTHGSNGAGYTHTVKQEHSNNRPVENIQIGQGWNGGKKITAEN
FT                   FPAVFDAVYKELEHRLSDAINSSDEIGLENFL"
     atgtcacacg ttacttcaag agcctcatgg ctctcactct tgctggtgtc actgctggta        60
     gtgtctactg tcaacgcgct tccaatctac cagacagacc aacagataga aggacaagtc       120
     ggtaaacttg aatctcgatc accgaggctt attccagaca ctgcggaata cgtccatgac       180
     atcctgcaag ggctgggcct gacaaagcca agcccaagct caaccgcaac atccagtgcc       240
     acgcccactt ccacacccac ttccacgccc actgccagca tcaaggacga gcaagacgtg       300
     gaatatatga agccaacaca taccacgcac atcatctact ccagctccac cagttacaca       360
     ccgactcatg gcagcaatgg ggcgggctac acccataccg tgaaacagga gcacagcaac       420
     aacaggccag tggagaatat ccaaattgga caaggttgga atgggggtaa gaaaattact       480
     gcggagaact tccctgcggt ctttgatgct gtatataagg agctggaaca tcgattgagc       540
     gatgcgatta acagttctga tgagattgga ttggagaact tcctatga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page