(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE485

PENCW_13.PE485       Location/Qualifiers
FT   CDS_pept        join(complement(1137411..1138038),
FT                   complement(1137123..1137337),complement(1136980..1137072),
FT                   complement(1136868..1136906))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217063" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948793"
FT                   /orf_name="Pc16g04850"
FT                   /product="Pc16g04850 protein"
FT                   /protein_id="CAP93155.1"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniParc:UPI0001831973"
FT                   /db_xref="UniProtKB/TrEMBL:B6H996"
FT                   /transl_table=1
FT                   /translation="MVGVQVDNLAVNDGPLTSENATLLRPSDPTLPLEELRKRYDEDGY
FT                   LLLKGVLPREDVLAARDAYFSSLESTGVLKPGTTPVEGVFDPAKDHLDYPGIGAGHIGG
FT                   NGKPGGERAAAFVDLALDAHYQDWYANKFCNHPALYDFIARFSDWGKNTLSMRRTLLRN
FT                   NLPKSKPIGVHYDQIFLRYGDPTSITAWVPMGDIKLNGGGLIYLENGDKVGIEMEEAFF
FT                   TKAKQAGLTDEEAKSAFNSNMMSTGLLSEFPTDFAREHGQRWMVSAYEAGDVVLHKPHM
FT                   IHASTVNNDPDNVIRLATDLRFCDSSKPYDKRWMNHYTFNDGV"
     atggtcggcg tccaagtaga caatctcgcc gtgaacgacg gccccttgac atcggagaat        60
     gccaccctcc tccgcccctc agacccaacc ctcccgctcg aagagcttcg caaaagatac       120
     gacgaggacg gctacctctt actgaaagga gtcctgcccc gtgaggacgt cctcgccgcc       180
     cgcgatgcat acttctcctc cctggaatca acaggagtcc tgaagcccgg cacaacaccg       240
     gtagaaggtg tcttcgaccc cgccaaggac catctagact accctggtat tggggcaggc       300
     cacattggcg ggaacggcaa gcccggtggt gagcgagcag cggcctttgt cgatcttgct       360
     ctcgacgcac actaccagga ctggtacgcg aacaagttct gtaaccaccc agcgctgtat       420
     gattttattg cgcgcttctc cgattggggg aagaatacct tgagcatgcg tcgcacgctt       480
     ctcaggaaca acctccccaa atcgaagccc attggcgtgc actatgatca gatcttcttg       540
     cggtatggag atccgacgag tatcactgct tgggttccca tgggagatat caagctcaac       600
     gggggtggat tgatctactt ggaaaatggt gacaaagtcg gaattgaaat ggaagaggcc       660
     ttctttacca aagcgaagca ggctggactg acggatgaag aggccaagtc ggctttcaat       720
     tcgaatatga tgtccacggg cctgctctcg gagttcccga ctgacttcgc tcgcgagcat       780
     ggtcaacgat ggatggtgtc ggcgtatgag gcaggtgatg tggtgttgca caagcctcat       840
     atgatccacg cttctactgt caacaacgac ccggacaatg tcatccgtct tgcgacagat       900
     ctacggttct gcgactcatc caagccttat gataagagat ggatgaacca ttataccttt       960
     aacgacggtg tctag                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page