(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE487

PENCW_13.PE487       Location/Qualifiers
FT   CDS_pept        join(complement(1142250..1143278),
FT                   complement(1141465..1142154))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000235013" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824617"
FT                   /orf_name="Pc16g04870"
FT                   /product="Pc16g04870 protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /protein_id="CAP93157.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="UniParc:UPI0001831974"
FT                   /db_xref="UniProtKB/TrEMBL:B6H997"
FT                   /transl_table=1
FT                   /translation="MSRLEIALSSTPEHLLKHLLLGTVLLTSLYALYRRLLPKPLPGIP
FT                   FNQKSAQSIWGDVLELRDDPSGLAKWCSKQLENHGSPICQALMGPLSKPVVLVADVGNA
FT                   REMLMGRSDFDRSAYIIDRFPLFGEFHLNMKTGDNWRQSRNWLKDLLAPQYLHNVAGPA
FT                   IHSSVLKLIELWQHKFHVGDGRVFSMVSDLKTLALDVIVAFHFGSDFQDSALDRQIDHV
FT                   GKLDGSKLPSGEYNEVEFSKAPLHEFQQGLTDVGDKMAAIYTTKWPPLLVAWWVRYVSP
FT                   YYRPFFEAKDRFIRKHINLAVRRCRSDEDPSTGIDYMVHREEKAARKARREPVFDKQIM
FT                   VDEAYGNLIAGQHTTSAALVWILKLLADYPSVQEKLREELQGIFDSAMQENRLPTAAEI
FT                   IKSKLPYLDAVLEETLRLRAAMLVPRDAAKDTELLGHRIPKGTVVLLVCQGPDYKPSPP
FT                   SKYWSDVKASRMYPGKGNPDLEIFDPERWLVRNEKGDLEFDGSSYPQLAFGLGIRSCWG
FT                   RRLAMVEMRIMTTLMILKFELKDVPKGLRGHEASYDISYRAKKGFLHLKSRGEFP"
     atgtcgaggc tcgagatagc tctttcttcc acgcctgaac atcttctcaa acacctcttg        60
     ctcggaactg tacttctcac atctctttac gcactctatc gaaggctcct ccccaagccg       120
     cttccgggta ttcccttcaa ccagaagtcc gcccagtcaa tttggggtga tgtcttggaa       180
     ctccgagacg atccttcagg gttggcaaaa tggtgcagca agcaactcga gaatcacggc       240
     tcgccaatct gtcaggcgct gatgggtccc ctgtcgaagc cggtggtgct ggtcgcggac       300
     gttgggaatg cccgagagat gctgatggga cgaagtgact ttgaccgatc ggcatatatc       360
     attgatcggt tcccgctctt tggggagttt catctcaaca tgaaaactgg agacaactgg       420
     aggcagtcta ggaactggtt gaaggacctc cttgctccac aatatcttca caatgttgcc       480
     ggtcccgcta ttcattcctc ggtccttaaa ctcatcgagt tatggcaaca taagttccac       540
     gtgggtgacg gtagagtttt cagtatggtg tcagatctga agactctcgc tttggatgtt       600
     attgtagcct ttcattttgg ttccgacttc caagactcgg ctctcgatag acaaattgat       660
     cacgttggga agctcgatgg atcgaaattg ccctctgggg agtacaacga ggtcgaattt       720
     tctaaagctc cattgcacga gtttcagcag ggtcttacag atgtgggtga taaaatggcg       780
     gctatttaca ctacaaaatg gccgccactt ctcgtagctt ggtgggtgcg ttacgtttct       840
     ccttactaca gacctttctt tgaggcgaag gatcgattta ttcgcaagca catcaacctt       900
     gctgtgcggc gctgtcgaag cgatgaagat ccttccacgg ggattgatta tatggtacat       960
     cgagaagaaa aggcagcccg aaaagcacgt cgtgagccgg tgtttgataa gcagataatg      1020
     gttgacgagg catacggcaa cctcatcgca ggacaacata ccacgagtgc agctctcgta      1080
     tggatcttga agttgttagc cgattatccc agcgtccagg agaagctccg cgaggagctg      1140
     cagggaatct ttgacagtgc gatgcaagag aatcggctac ctacagcagc tgaaatcata      1200
     aaatcgaagc ttccgtactt ggatgctgtg ctggaggaaa ctcttagact acgcgcagcg      1260
     atgctagtcc cacgcgacgc agcaaaagat acagagttgc ttggtcatcg cattccgaag      1320
     ggtacagttg ttctacttgt ttgccaagga ccggactaca agccgtcacc tccgtcgaaa      1380
     tactggagtg atgtcaaagc gtcaagaatg tatcctggca agggcaaccc tgacctggag      1440
     atatttgatc cagagcgatg gcttgtgcga aatgagaagg gggatcttga gtttgatggg      1500
     tcaagctatc cacagttggc cttcgggttg gggattcggt cttgttgggg acgtagactt      1560
     gccatggttg agatgaggat tatgactacc ttgatgatac tcaaatttga gttgaaggat      1620
     gtcccgaaag ggttgcgtgg gcatgaggcg agctatgata tttcctatcg ggcgaagaaa      1680
     ggattccttc atctgaagag tcgtggggaa ttcccttga                             1719
//

If you have problems or comments...

PBIL Back to PBIL home page