(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE488

PENCW_13.PE488       Location/Qualifiers
FT   CDS_pept        join(complement(1146249..1146329),
FT                   complement(1145944..1146216),complement(1145743..1145885),
FT                   complement(1145168..1145653),complement(1144081..1145113))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235014" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948794"
FT                   /orf_name="Pc16g04880"
FT                   /product="Pc16g04880 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP93158.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831975"
FT                   /db_xref="UniProtKB/TrEMBL:B6H998"
FT                   /transl_table=1
FT                   /translation="MQGQKRRVRTCHSCYTRKQKASESDSICDRQYPCNHCTRRRRPEE
FT                   CVYGPPPVKVPSCPPVPADQSETQPRPVESARPTRETPVDDSEAHWSREHSALARSFGY
FT                   FEDSNSNTMALLRRLELPDQSDTELKNAWPSTWETIHHELDLMPERQIIDFLVQYFVYE
FT                   LNWMKQVIHVPSFLANYQLWWAKDKIVEIADVEFAALIARICSYATQFLPSPSHTVDQI
FT                   RGRSLADIRDTCSNIGNKLATACETLDWKGTLVRVQHIIFAALKVSCEGRTSQFWEGIG
FT                   SACRAAQKAGIHTDTTGLESQLAKDSAQELERDVQRRTFCSLYVLDSHLSRQLDRIPFL
FT                   SNHLIEETLPRLRLIPDIGNIPTETATRAPDIFTERLMQVQLGLFWRGLGLQRTCEFDP
FT                   TESERIYEKFNSEYLNNLHPAFAIAHPDTTLDKALPKLPMQRQLLYIAIFDSICWNFRP
FT                   LLLLKPDQVASLAPYKKVLLRSQKRRLGMAALKVLEAVAALHTMFGGSYTRFSAIIFNS
FT                   FEPAILLLNLCSHADFPFDQDDNSTSLVGTKVRMTYRIAMQAVEQAIHRLQMLADLSDM
FT                   AASGARVATLLFARSVQPKQSSSPPALTLSVSGSLGPSQFPTPIERYGEQENWPSLEAG
FT                   DPYSMPDNFPSMAQDSFPSPQLSSLKFPVVWGEAFF"
     atgcaaggcc aaaaacgtcg tgtcagaacg tgtcattctt gctatacacg taaacagaaa        60
     gcgagtgaat cagactcgat ttgcgaccgc caatatccat gcaaccactg tacccgtcgt       120
     cgccgacccg aagagtgtgt ctacggtcct ccgccagtga aagtgccctc ctgtccgcca       180
     gtccctgcag atcagtcgga gacccaacct cgaccggtag agagtgcacg gcccacgcga       240
     gaaacacccg tggatgactc cgaggctcac tggtccagag agcattctgc cctcgctcga       300
     tcatttggtt attttgagga tagcaactcc aatacaatgg ctttgctccg acggctggaa       360
     ttgcctgatc aatctgatac agagctgaag aatgcctggc cctctacttg ggaaaccatt       420
     caccatgagc tcgatctcat gcctgagcgc caaatcatcg actttcttgt gcaatatttc       480
     gtctatgaat tgaattggat gaagcaagtc attcacgtcc ccagcttctt ggcaaattat       540
     cagctgtggt gggcaaagga taagatagtg gagattgccg acgtcgagtt tgcggctcta       600
     attgctcgca tttgttctta tgcgacacaa tttctgcctt caccgtctca taccgttgat       660
     caaattcggg gtcggtcact agccgacatt cgtgacacct gcagtaatat tggaaacaag       720
     cttgcaacag cgtgtgagac tcttgactgg aaaggcactt tggtccgtgt tcaacacatc       780
     atttttgctg cattaaaagt ctcctgtgaa gggaggacta gccaattttg ggagggcata       840
     ggttctgcat gtcgagctgc tcaaaaggct ggcatccaca ctgatactac tggcttggaa       900
     tctcagcttg ccaaagatag tgcccaggag ttagaacgag atgttcagcg gaggacgttt       960
     tgcagccttt atgttttgga cagtcatttg tccagacaac tagatcggat ccccttctta      1020
     tccaatcact tgattgagga aacactaccc cggctgcgct tgatcccaga tattggcaat      1080
     ataccgacag aaactgctac cagagcgccc gacatcttca ccgaacgtct catgcaagtt      1140
     caacttggcc tgttttggcg aggccttggg ttacagcgta cctgcgagtt tgacccgacc      1200
     gagagtgagc ggatatatga gaagttcaac tccgagtatc tcaacaactt acatccggcc      1260
     ttcgctatag cgcacccaga cacgacttta gacaaggctc ttccaaagct acccatgcaa      1320
     agacaacttc tatacatcgc gatcttcgac tcaatttgtt ggaacttccg acctctcctg      1380
     ctgctcaaac cagaccaagt cgcaagctta gctccctaca agaaagttct tctccggtcg      1440
     cagaaacgga ggcttggtat ggctgcactg aaagtgctcg aagctgtggc agcccttcat      1500
     acaatgtttg ggggctccta tacgcgcttt tctgcgatta tctttaactc ttttgagcct      1560
     gcaattcttc tgcttaatct ttgttcccat gcagatttcc catttgatca agacgataat      1620
     agcacaagcc ttgtgggaac caaggttaga atgacatacc gaatagcaat gcaggcggtg      1680
     gagcaggcca ttcatcgtct tcaaatgtta gccgacctaa gtgacatggc tgcatctgga      1740
     gcccgcgtgg ctactctgct ttttgccaga agtgtgcagc ccaaacagtc atctagtcca      1800
     cccgctctca cattgtctgt ttctggctct ttagggccat cccagttccc aactccgata      1860
     gaaaggtatg gtgaacaaga aaactggcca tctttggaag caggggatcc ttattcaatg      1920
     cccgataatt ttccctcaat ggcgcaagac tcttttccaa gcccccagct ttcctcctta      1980
     aaattccccg tggtctgggg ggaagcattc ttctag                                2016
//

If you have problems or comments...

PBIL Back to PBIL home page