(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE489

PENCW_13.PE489       Location/Qualifiers
FT   CDS_pept        join(1147269..1147320,1147372..1148218,1148278..1148839,
FT                   1148960..1154893)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235015" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948795"
FT                   /orf_name="Pc16g04890"
FT                   /product="Pc16g04890 protein"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="oxidoreductase activity"
FT                   /function="transferase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP93159.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020842"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="UniParc:UPI0001831A4E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H999"
FT                   /transl_table=1
FT                   /translation="MTAPWPVKHDPIALVGIGCHMPGGVRDIPALWEFLRKQKDVHREF
FT                   DEPRFSAKGFSHSNPDRPGTAVARSGFLLDEDPRLFDAAFFGITDNEVETMDASQRKLL
FT                   EVTYEAFENAGETWEGVSGSRVGVFVGDISFDNYVSQTRDWDYGGKYSATGAFPNMLAN
FT                   RIHYVFNLKGPSLLVNSACTSAMYALHLAMNSIRNGDCESAIVAGSNWIMDPNCHIAMG
FT                   KLGALSATSRSHTFDASADGYARGEGFAALYLKKTSLAIEDGSPIRALIMGSAINANGR
FT                   TNGITNPSGPAQEIVIREAYKNAGNLDPSQTTFLECHGTGTRVGDPTEIKAAGNVFGPS
FT                   RAFEQNDQLVVGSVKTNLGHLEGACALPGILKVVAALEQGEIPPTLGFQTPNPRIDFKQ
FT                   AKARVSTQVEPWPKDKLKRASVTSAGFGGTNGHCIIDHVHNLLPSYVKPGIVGQRVEQL
FT                   NGQNGINGTNGTNGTNGTNGTNGTNGTNGHHNPKTEAPKLVRKADAGTRKLVVFPFSAH
FT                   NQTSLVANVDSLNEVIHQHSLADVAYTLSARRSRFMHRTYCIADKDQVPETGLKQENKL
FT                   EIVSSPQRVSAGFIFTGQGAQWHAMGAGLLQYSVFQNVILYLDSVLSILPEPPSWRIAD
FT                   FIVGNCDTDSIQIPAVSQTVCTAVQIGLVDLLASWSVRPAGVAGHSSGEIAAAYASGRI
FT                   TAAEAIVAAYYRGYMVSFNNQRGAMLAVGFGPEKAMEYIREAGLEERLKVAAINSFDSV
FT                   TISGDADSVEDLSARLSKESVFNRLLRTGGLAYHSHHMLPFGSAYEEKVNDGLRHIKSL
FT                   GVDTTSAKYPFIPWTSSVIPDKSTTEVTASYWRANLESPVRFTDAVSNLLSLPGLNIGA
FT                   LIEIGPHPALKGPLGQTMKSLGKVIPHIASLKRNEDAQRLMLDCAGTLFALNVPVNLVA
FT                   VNAIDGQGPKGEHHLEYGCTAIDLPRYKYTYGPIKYHESRLSKEYRLRPTPRHDLLGSK
FT                   VPGTTKLRPQWRNMLRLKDLGWLNDHRVPPHVLHPGAAHIVMAMVAAEHKYNEFPDALP
FT                   IIGLTMRNVSIKKTLVVPEDDHGVEIVLSMELEDGATAKSPGWASFSIASVVRDSDQWT
FT                   EHCSGQIKIEVSTFEQATPISTTMDGRLVDAQTWYTRFADMGLQFGPSFQGYSDIRADP
FT                   AKNIASARLALNTTAGMFPGGESTYPIHPASLDLVIRLGLMACNGGQAETASVQLPIHF
FT                   NQMKFNYGHLEGRDWATGVSRGELRGLRGAYAQLQMLDEEGKVMLDIDNMRFTSLNNEQ
FT                   ESTSTGDRACKAYSSPFARLVWRPDIRTLSKDQFNEALKCCQENVGEFPQLCKIFDLAG
FT                   HANPDLRVLELGASSNAGAGKAVLKTLVGSNNIKRYREYVATDTTEERLESVRESTAEF
FT                   RDVKYSVLDINEVPSEQGFQSGLYDIIICSDGPQTLQAMQHLRKLVTPAGRLVQVSRTG
FT                   REITSESLRNVDFELVGEVTEPAHHSTITVHALRVTERHQIHSNRLVHLLHGDQGAPEL
FT                   LHRLAQVLGDLGIAIKVSSLDDTQSVVAPNSHVVAFLDGDNLLFAASQHRIGLFQHLAA
FT                   NTASMMWLTSCGLVKGRNPDGSFVSGLLRTLAAENPAGQFLSVDIDAKDFRVQDTEMDT
FT                   LVRSLVDVVLSLQQTSEDSHDIVVNHDLAWQDGNMWVSRLVPDAELQGYDQTTMDDQNM
FT                   KAVPLSTLGPVRAAFRTPGILTSLYFKPYTELWETLPHDWIEIKLEAVGLNWKDLGLCS
FT                   GRFDQNNLSNEYVGVVSDMGSSVHDLSIGDRVYGMGKGHFGNYTRVPAVLAQKLEAGVD
FT                   SLEAATMPLVYMTAVYAFEHITRVRKGSKVLIQSASGGLGLAATQLALSKGADVYVTVG
FT                   TADKAQFLSDVMGISSDHIFSSRRLTDVPRMISATKNGGFDVILSTSQGDMLYESIKAL
FT                   APLGHLIDVGRMDVTSAKTVALELFHKSASFTSFDLGLVIERDVELGGDLMFAVNQHFR
FT                   AGRIGPIRPYHVSDISQLDQALLKLSKGTHIGKMVISYQNPSSLLSVHQSVTHARFLQE
FT                   ANYILVGGMSPLGRCIIRWMVSRGAQHLSVWSRRGGNNLSPEAAALIDEMTSQGVRIQL
FT                   VTCDVSNREQVLRSMQEANSERAVRGVFNYAVSYQDISFDKMTADMFCQGMAAKVFGTK
FT                   NLHEATANLPLDFFTMTSSLGTVYAFPTQSTYLAANNFLDYFARYRRQSGLPATTVSLG
FT                   FINDLGALTQDEVTVNLFARTKGQTVTGSQVLRALEPAFVKHLNTKDQWLGRWEDPLSA
FT                   ANIFTGIDPAVLANMKRAEGKGSASGTVPRWYHDPRVSLMLRAMDDAWRHGNGEDSDKA
FT                   TFGFDDADQSPAVQLRRHFEASIKKTRNGQDKEEVAETVTFVTDAIRTTVAGMLFIDPS
FT                   VVKENHTVVDHGIDSLLAAEFRTWLNSSFGKNISMLKLMDARSSIGSIAQVIVEEAIGA
FT                   "
     atgactgcac catggcccgt caaacacgac cccattgccc ttgttggcat cggttgccat        60
     atgcctggtg gtgttcgaga cattcccgcg ctatgggagt tcctcaggaa gcagaaggat       120
     gtgcacaggg agttcgatga gccacggttc tcagctaaag gattctctca ttccaaccca       180
     gatcgtcctg gtaccgcggt ggccagaagt gggttcctcc tggacgaaga tccacggctc       240
     tttgacgcag ccttcttcgg catcacggac aacgaagtag agacaatgga tgcgtcccaa       300
     cggaaacttc ttgaggttac atatgaggcc ttcgagaatg ctggcgagac ttgggaaggt       360
     gtatctggct ctcgcgtcgg cgtgtttgtg ggtgacatct ctttcgacaa ctatgtgtcc       420
     caaactagag attgggacta tggtggaaag tattcggcca ctggtgcatt ccccaatatg       480
     ctggccaacc gcattcacta cgttttcaac ctcaaagggc ccagcttgtt agtcaacagc       540
     gcgtgcactt ctgcgatgta cgcccttcat ttagccatga actcaatccg caatggagat       600
     tgtgaatccg ccattgtggc ggggtccaac tggatcatgg accctaattg ccacatagca       660
     atggggaaac tcggtgctct ttccgccact tctcgaagtc atactttcga cgcatcagct       720
     gatggctatg cacgtggtga gggattcgct gctctttacc tgaagaagac ttctctggcc       780
     attgaagacg gatcccctat tcgcgccctg attatgggct ctgcgatcaa cgcaaacggc       840
     cgtaccaacg gaattaccaa ccccagtggt cctgctcaag agatcgtcat tcgagaagcc       900
     tacaagaatg caggcaatct tgatccttcg caaactacgt ttctcgagtg ccacggaact       960
     ggcacccggg ttggtgaccc aaccgagatc aaagcggctg gaaatgtttt tggtccttcg      1020
     cgggcctttg aacaaaatga tcagttggtg gtgggttctg tgaagacaaa tctcggtcac      1080
     ttagagggag cttgcgccct tccaggaata ttgaaagtgg tcgcagccct tgaacaggga      1140
     gaaatcccgc ccactctcgg atttcagact ccaaacccgc gcattgattt taagcaggcg      1200
     aaagcccggg tctcaaccca ggttgaacca tggcccaaag ataaactcaa gcgagcaagt      1260
     gtcacttctg ctggttttgg tggcaccaac ggacactgca tcattgacca tgtccacaac      1320
     ctccttccat cctatgtcaa gcccggtatt gttggtcagc gtgtcgagca actgaatgga      1380
     caaaacggca tcaatggcac caatggcacc aacggcacca acggcaccaa cggcaccaac      1440
     ggcaccaacg gcacaaacgg ccatcataat ccaaagactg aggcaccaaa attggtccga      1500
     aaggccgacg caggcactcg gaaactggtg gtttttccct tctcagcgca taaccaaacc      1560
     tcacttgtag cgaacgtcga ctcattgaat gaagtcatcc accagcactc actggccgat      1620
     gttgcctata ctctcagtgc tcggcgctcg cgcttcatgc atcgaactta ctgcattgcc      1680
     gataaggacc aggtgccaga aacgggactg aaacaggaaa acaagcttga aattgttagt      1740
     tcgccccagc gtgtttctgc tggtttcatc ttcacaggac agggtgcaca gtggcatgcc      1800
     atgggcgccg gacttctcca atactctgtt ttccaaaatg tcatcttgta tctggacagc      1860
     gtcctttcca tattgcctga gcccccctca tggaggatcg ccgatttcat tgttggaaat      1920
     tgcgacacgg attccatcca gattcctgca gtgtcacaga ccgtttgtac ggctgtccag      1980
     attggtctcg ttgatctcct tgcttcatgg tctgttcggc ccgcgggtgt agcgggccat      2040
     tcttccggtg aaattgcagc agcgtatgcg tcgggacgaa tcactgctgc cgaagctatt      2100
     gtagctgcct attatcgcgg ctatatggtc tctttcaaca atcagagggg cgctatgctg      2160
     gcagtcggtt tcggacctga gaaagccatg gaatatatca gggaggccgg tctagaagaa      2220
     cgactcaaag tcgctgcgat caactcattt gacagtgtta caatctccgg tgatgctgat      2280
     tctgtggaag atctgagcgc acgactttcc aaggagtcgg tctttaatag actgctccgc      2340
     actggcggac tcgcatacca ctcccaccac atgttaccat ttggctcggc atatgaagaa      2400
     aaggtcaatg atggtcttcg tcatattaag agtcttggcg ttgataccac aagtgccaag      2460
     tatcctttca ttccttggac ttcttcggtc attccagaca agagtaccac tgaagtgact      2520
     gcatcttact ggagggccaa tcttgagtcc ccggtacgtt tcaccgatgc agtatcaaat      2580
     cttctgagcc ttccgggcct aaacattggt gccttaatcg agattggtcc gcatcccgcc      2640
     cttaaaggcc ccttgggaca gaccatgaaa agcctgggaa aagtcattcc gcatattgcg      2700
     tctttgaaaa gaaatgaaga cgcccaaaga ttaatgctag actgcgctgg aaccttgttc      2760
     gcgctcaatg ttcctgtcaa cctggtggct gtcaatgcta tcgacggaca gggacccaaa      2820
     ggagagcacc acctggagta cggctgcact gcaatcgacc taccgcggta caagtatacc      2880
     tatggaccta tcaaatacca cgagagcaga ttgagtaaag aataccggtt gcgtcccact      2940
     cctcgccacg atcttctggg ttctaaagtg ccaggaacta cgaagcttcg gccccaatgg      3000
     cgcaatatgc ttcgtctgaa agatctgggc tggctgaatg atcaccgtgt gcctcctcat      3060
     gttttacacc ctggtgccgc tcatattgtc atggccatgg tcgctgcaga gcataaatac      3120
     aacgaattcc ccgatgctct gccaatcatt gggctaacca tgcgcaacgt ttccatcaag      3180
     aagacattgg tggttccaga ggatgatcac ggcgtcgaga ttgtgctgag catggagctt      3240
     gaagatggtg ctaccgccaa gtcgccaggc tgggccagct tctccattgc ctcggtagtc      3300
     cgcgactcag atcaatggac cgagcactgc tcgggtcaaa tcaagattga ggtctctacc      3360
     tttgaacaag ccacgccaat cagcactact atggacggac gactagtgga tgctcaaacc      3420
     tggtacacac gctttgctga catgggtctc cagtttggac cctcgttcca aggctactcg      3480
     gacatccgtg ctgatccagc caagaacatt gcgtctgcca ggttggcctt gaataccacc      3540
     gccggtatgt tccctggcgg cgagtcgacc taccccattc acccggcttc tttggatcta      3600
     gtgattcgcc tgggtctcat ggcctgcaac gggggccaag cagaaacggc cagcgtccag      3660
     cttccgatcc atttcaacca gatgaaattt aattacggtc acctagaagg tcgcgattgg      3720
     gcgactggtg tgtcccgggg cgagctgcgc ggcctccgtg gggcgtatgc tcagctgcag      3780
     atgctggatg aggagggcaa agtgatgttg gatatagaca acatgcgttt cacaagtctc      3840
     aacaacgaac aagaatctac atccactgga gaccgggcct gcaaggcata ttccagccct      3900
     tttgcgcgcc tcgtatggag acctgatatt cgtaccttgt ccaaggacca gttcaatgag      3960
     gctctgaaat gttgccaaga gaacgttgga gaattccctc agctttgcaa gatctttgac      4020
     ttagctggac atgctaatcc agacttgcga gttctggaat tgggcgcaag tagtaatgcg      4080
     ggcgcaggta aagcagtctt gaagacactc gtgggctcca acaatattaa gcgctaccgg      4140
     gagtacgttg ctaccgacac cacggaagaa cggctcgaat cggttcgaga aagcactgct      4200
     gaattccgtg atgtgaaata ttctgttctg gatatcaacg aagttccgtc agagcaaggc      4260
     ttccagtcag gtctatatga cattatcatt tgctcggatg gcccgcaaac tctccaagca      4320
     atgcaacact tgaggaagct tgtcactcca gccgggcgct tggttcaagt gagccgtaca      4380
     ggaagggaaa ttacctccga gagccttcga aatgtggatt ttgaacttgt tggtgaagtg      4440
     actgagccag ctcatcattc gaccatcacc gttcatgccc tccgtgtcac agagcgacat      4500
     caaattcatt ctaacagact cgtgcacctg cttcacgggg atcaaggggc cccagaatta      4560
     ttgcaccggc ttgcccaggt actgggcgac ctcggaattg ccatcaaagt ctcttcgctt      4620
     gatgatacac aaagcgtcgt ggcacccaac tcccacgtgg ttgcattcct agacggtgac      4680
     aacctcctgt ttgcagcgag tcagcatcga attggattgt tccaacacct ggcagcgaat      4740
     actgccagca tgatgtggct cacgtcgtgc ggtttggtta agggccgcaa ccctgatgga      4800
     tcctttgtct ctggactgct gcgcacatta gcagctgaga atcccgccgg tcagttcctt      4860
     tccgtcgaca tcgatgcgaa agatttccga gtccaagata ccgagatgga tacactagtc      4920
     aggtccttgg tcgatgttgt tctctcattg cagcaaactt cagaggacag ccacgacatt      4980
     gttgtgaatc acgacttggc ctggcaagac gggaacatgt gggtgagccg gcttgttccc      5040
     gacgctgagc ttcagggata tgatcaaact actatggacg accaaaatat gaaggcagtc      5100
     ccactttcca ctcttggtcc cgtccgtgca gctttcagaa cccctggtat tctcacatcc      5160
     ctctatttca agccatacac cgagctctgg gagaccttgc cacacgactg gattgagatc      5220
     aagctggagg ccgtcggtct gaactggaaa gatctgggtc tgtgctccgg tcgattcgat      5280
     cagaacaatc tctcgaatga gtatgtcggt gtcgtctccg acatggggtc ctctgtccac      5340
     gatcttagca tcggtgaccg ggtttatggt atgggcaagg gccactttgg aaactataca      5400
     cgcgtgcccg cggtgcttgc acagaagcta gaagctggcg ttgactcgtt ggaagctgca      5460
     acaatgccct tggtctacat gacggcggtg tatgctttcg agcacatcac tcgcgtaagg      5520
     aagggctcaa aagttctgat tcaatcggcc tcgggtggtc tcggactggc agctactcaa      5580
     ctggctctgt ccaagggcgc tgatgtctat gtcacagtgg gcaccgcaga caaggctcaa      5640
     ttcctgtccg atgtcatggg gatttcatcc gatcacatct tctcctctcg aagactaaca      5700
     gatgtacctc gcatgatcag cgcaactaag aatggaggat ttgatgttat tctcagcaca      5760
     tcccagggag atatgctcta tgaatcgatc aaagcattgg caccgcttgg tcatctgata      5820
     gatgtcggcc ggatggatgt cacgagcgca aagacagttg ctcttgagct tttccataag      5880
     agcgcaagct tcacttcctt tgatctaggc ctggtgatcg aacgcgacgt tgaacttggc      5940
     ggagatctca tgttcgcagt caatcagcat ttccgcgccg gccgcattgg tcctatccgt      6000
     ccataccatg tgtcggatat ttctcagctt gaccaagctt tgttgaagct ctccaaagga      6060
     acacacatcg ggaaaatggt gatctcctat caaaatccta gttctcttct gagcgtacac      6120
     cagtctgtca ctcatgcccg gtttttacag gaggctaatt acattctcgt tggcggaatg      6180
     agtcctcttg gacgatgcat catccgatgg atggttagtc gaggagctca gcacttatct      6240
     gtttggtcaa gaaggggtgg aaacaatctg tcccctgaag ctgcggcctt gattgatgaa      6300
     atgacgtccc aaggtgtgcg tatacagctg gtgacgtgcg atgtcagcaa tcgcgagcag      6360
     gtccttcgga gtatgcaaga ggctaactct gagcgcgccg tgcgaggagt cttcaactat      6420
     gcagtctcct accaagacat ctcatttgat aaaatgaccg cggacatgtt ttgccaaggc      6480
     atggcggcca aagtgtttgg tacaaagaac ctacacgaag cgacagccaa cctgcctttg      6540
     gactttttca caatgacctc ttcgctggga actgtctacg cgttcccgac acagagcaca      6600
     tatctcgctg ccaacaactt cctcgattat ttcgcacgtt accggcggca atccggttta      6660
     ccggcaacta cggtgtcact cggtttcatc aacgacctgg gagcccttac ccaggacgaa      6720
     gtcacagtca atttgttcgc gcgcacgaaa ggtcaaacag tcacgggtag tcaggttctg      6780
     cgtgctctgg agccggcatt tgtgaaacac ttgaatacta aagaccagtg gctcggtcgt      6840
     tgggaggatc cgctgtccgc ggccaatatt tttactggca tcgacccagc cgttttggcg      6900
     aacatgaagc gggcggaagg caaggggtct gcttcaggta ctgtgccccg gtggtaccac      6960
     gatccccgcg tgtctttgat gctgcgcgcc atggacgatg cttggcgcca tgggaacggg      7020
     gaggatagcg acaaagcgac attcgggttt gatgatgccg accagtcacc tgctgtacaa      7080
     cttcgtcggc acttcgaggc atcaatcaag aaaactagaa atggtcagga caaagaagag      7140
     gtcgcagaga cggtcacatt cgtcactgat gctatcagga ccacagttgc gggcatgttg      7200
     ttcatcgacc catctgtggt gaaggaaaat cacacagtag ttgaccatgg aattgacagc      7260
     ttgttggctg cagagttcag gacatggcta aattcatctt ttgggaagaa cattagcatg      7320
     ttgaaactga tggatgcgcg atcgagtatt ggttccatcg cgcaggtcat tgtggaggag      7380
     gccattgggg cttag                                                       7395
//

If you have problems or comments...

PBIL Back to PBIL home page