(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE490

PENCW_13.PE490       Location/Qualifiers
FT   CDS_pept        1156930..1157784
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217158" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948796"
FT                   /orf_name="Pc16g04900"
FT                   /product="Pc16g04900 protein"
FT                   /protein_id="CAP93160.1"
FT                   /db_xref="UniParc:UPI0001831A4F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9A0"
FT                   /transl_table=1
FT                   /translation="MSSNIKSELDTEASSSSFLGDLGPPIRRYPYKGTKQFLETVKMEL
FT                   SRQEEEFEASEWVLFTKVNEQAFSRDFLNSDDNILQRCWNSYDSSQHLLLVKMTVSRAH
FT                   EIAARVFERLFFDCLKPMDLDDCLQTFGSATCKAENGSAKQPDCQFLPRRLPRARTKKW
FT                   PSVVVETGFSESPSKLTSDARFWLSESNGDVQMVITVKIGRSSPNIVLESWELVNNRVQ
FT                   RQQVITISKGDNNHVYLRGQPLIISFNKLFLRPPSIPKEINISLDDDILKKIARNVWEE
FT                   QGF"
     atgtcctcga acataaaatc tgagctagac accgaggcct ctagcagcag ctttctcggt        60
     gatctaggac ccccgatcag aaggtatccg tacaagggga ctaaacagtt tttagaaact       120
     gtaaagatgg aactaagtcg ccaggaagag gaattcgagg ccagtgaatg ggtgctcttc       180
     accaaggtta atgagcaggc cttcagtcgt gacttcctaa actcggacga caatatcctt       240
     cagcgttgct ggaattctta cgactcttcc caacaccttc ttcttgtcaa aatgacagtc       300
     tcacgcgctc atgaaattgc ggcacgcgta ttcgaaaggc tcttttttga ttgtcttaag       360
     ccaatggacc tcgatgactg tcttcaaacc tttggatccg ccacttgcaa agcagaaaat       420
     ggctccgcta aacaacccga ctgccaattt ttaccaagaa ggcttcctcg agctcgaacg       480
     aagaaatggc catcggttgt cgtggaaacg ggcttttcag agtcgccttc caaattgacg       540
     tccgatgctc ggttctggct ttccgaatca aacggtgatg ttcaaatggt catcacagtc       600
     aagatcggtc ggagctcgcc caacatcgtg ctggagtcat gggaacttgt gaacaatagg       660
     gtccaacgtc agcaagtcat taccataagc aaaggcgata acaatcatgt ctacctccgg       720
     ggccagccgc ttattatcag cttcaataag ctctttcttc gcccaccgag catcccgaaa       780
     gaaataaaca tcagccttga cgacgatatt ttgaagaaaa ttgctaggaa cgtctgggaa       840
     gagcaaggtt tttga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page