(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE491

PENCW_13.PE491       Location/Qualifiers
FT   CDS_pept        1158871..1160532
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169919" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948797"
FT                   /orf_name="Pc16g04910"
FT                   /product="Pc16g04910 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP93161.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831A50"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9A1"
FT                   /transl_table=1
FT                   /translation="MTAISSTPASDSENQNVSQASEDYLHQPNEKDHSSDPGASDDVRK
FT                   ITGYRWFLICAALYLSALMYGLDTTIAADVQGAVIQRFGQVDQLAWIGAGFPLGSVAVI
FT                   LPYGFLFTTFNMKWLYIAGIVLFQGGSALCGGAPNMGALIVGRVIAGAGGTGIYLGGLN
FT                   HFSAMTTRNERGAYLAGTGFVWGLGAILGPVVGGGFSDSSATWRWGFYINLIIGAITAP
FT                   VYLFYLPAIHPAPGRPLKDRLLSLDYVGFVLSAAMWATFAMGFIFAGGIWQWNDGRTIA
FT                   MLVVWGVMLALYALQQTFCIFTTPEHRSFPGHLLRSRTQILFYVTTTCANTCMFFTTFY
FT                   IPIYFQFTRNDSSLMAAVRLLPYLLFTIAFNLASGAALPKIKYYMPMCLVSGIFMTIAG
FT                   ALFVGYLSPSTPTGQIYGFSILMGVGTGITMQLGYSVGSLKVKPTDALSAINLQNVAQI
FT                   GATVICLVIASQAFQSNAIRNLDHVLAGQGFSQSEIQSAVAGSQSTLFEQLSGDLRTAA
FT                   IEAITSAMARAFIIPLVAGALGLVCSLLMSRERLFG"
     atgaccgcaa tatcgtctac tcctgcctca gactccgaga accaaaatgt gagccaagca        60
     agcgaagact acctccatca acccaacgaa aaggatcact cgagtgatcc gggtgcgagc       120
     gacgatgtac gcaaaatcac gggctatcga tggttcctaa tttgcgctgc tctttacctc       180
     tcagcattga tgtacggact agatacaacg attgctgcgg acgttcaagg ggcggtaatt       240
     cagaggtttg gccaagtcga ccaactcgcc tggattgggg ccgggttccc tcttggatcg       300
     gtcgctgtta ttctgcccta cggatttctt ttcactacct tcaatatgaa atggctctac       360
     attgccggga ttgtgttatt tcagggcgga tctgctctct gtggtggagc tccgaacatg       420
     ggtgccctga ttgtcggacg tgtgattgct ggtgccggag gaactggcat ctatctagga       480
     ggactgaacc acttctccgc catgacgact cgaaatgagc gtggggcgta tctcgctggc       540
     actgggtttg tctggggctt gggagcgatc ctgggccctg tggttggtgg tgggttttcg       600
     gattcatctg ccacttggcg atggggattc tacattaatc ttatcatcgg tgctatcaca       660
     gcccctgtct acctgttcta ccttccagcc attcatccag ctcctggaag accacttaaa       720
     gatcgacttc ttagtctgga ctatgttggg tttgtgctca gcgcagcgat gtgggcgacc       780
     tttgcgatgg gcttcatctt tgccggtggt atctggcagt ggaatgatgg tcgtactatt       840
     gcaatgcttg tggtatgggg ggttatgctt gccctttacg cattacagca gaccttctgc       900
     atctttacca cccccgagca taggtcattc cccgggcatc tgctcagatc tcgaacccaa       960
     atcttgttct atgtcaccac cacctgcgcc aacacctgca tgttcttcac cacattctac      1020
     ataccgatct acttccagtt cactcggaac gactcatccc tcatggccgc agtgcgactt      1080
     cttccttacc tcctgttcac catcgcgttc aaccttgctt ccggcgcggc ccttcccaag      1140
     ataaagtact acatgcctat gtgtctcgtg tccggtatct tcatgactat agctggtgcg      1200
     ttgttcgtgg gatatctttc cccttcgacg ccaacgggcc agatctacgg cttcagtatc      1260
     ttgatgggag tcgggaccgg aatcaccatg caactgggct actccgtggg cagcttaaaa      1320
     gtcaaaccaa ccgacgccct cagcgctatc aacctacaga atgttgcaca gattggagcc      1380
     acagtcatct gtcttgtcat tgccagccaa gcgttccaat caaacgccat cagaaacttg      1440
     gatcatgttt tggcaggcca gggattcagt caatcggaaa ttcaaagtgc tgttgctgga      1500
     tcacagagca cgctgtttga gcagctcagt ggtgacttac ggactgccgc tattgaagca      1560
     atcacctcag cgatggcaag ggcctttatc attccacttg tagctggcgc attagggctt      1620
     gtttgctctc tgttgatgag tcgggagaga ctgtttggat aa                         1662
//

If you have problems or comments...

PBIL Back to PBIL home page