(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE492

PENCW_13.PE492       Location/Qualifiers
FT   CDS_pept        join(complement(1161392..1161989),
FT                   complement(1161161..1161333))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207984" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948798"
FT                   /orf_name="Pc16g04920"
FT                   /product="Pc16g04920 protein"
FT                   /protein_id="CAP93162.1"
FT                   /db_xref="UniParc:UPI0001831A51"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9A2"
FT                   /transl_table=1
FT                   /translation="MTFTIANPVLSNPVPTTKSLPNKGKDQEVPSLTRLLHHSHVTTEF
FT                   DPLIFAAAASLQLQLQPEKQYPDTETDTRLIASPYNSVPHLLDIAALERQDRLFALALA
FT                   YLKPIRDDYATAEYTESFNWTEVFDLLRAFSQAEDHTWRSQSYYVVIFRSTLLPGIDSD
FT                   RLYELDAHSHQEAIASGGLLKYWFGAKNDRLQNMATCIWRNRNDARLGGRGPWHAQARA
FT                   AATTMYEQIRFTTLRLVIEDGVQSWKLSDWKEDV"
     atgacgttta ccatagcaaa cccagtcctc agcaacccag tcccaactac caaaagcctt        60
     ccgaacaaag gcaaagacca agaagttcca agcttgactc gactcctgca ccacagccat       120
     gtcactacag aattcgaccc cttaatattt gcagctgccg catcattgca actgcaattg       180
     cagcccgaga agcaataccc agatacagaa acagacacgc gactcattgc atcgccctac       240
     aacagcgtcc cccatctgct ggacatcgct gcactggaaa gacaagacag actcttcgca       300
     ttggcattgg catatctcaa acctatccgc gatgactatg ccactgctga atacacggaa       360
     tcattcaatt ggacagaggt gtttgatttg ttgagagctt tctcacaggc agaggaccac       420
     acatggagat cacaatcata ctacgttgtt attttccggt ccacactgtt gccggggatt       480
     gattcggacc gtctttatga gttggatgcg cattcgcatc aggaggccat tgctagtggg       540
     ggattgttga agtattggtt tggggcgaag aatgacaggc ttcagaatat ggcaacttgc       600
     atttggcgca atcgaaatga tgcaagactt ggtggtcgcg gaccttggca tgctcaagca       660
     cgagcggctg ctacaacaat gtatgagcag attcggttca ctacgttaag gttggttatt       720
     gaggatggag tgcagtcctg gaagttaagt gattggaagg aagatgtata a                771
//

If you have problems or comments...

PBIL Back to PBIL home page