(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE495

PENCW_13.PE495       Location/Qualifiers
FT   CDS_pept        join(complement(1167905..1167975),
FT                   complement(1166830..1167496))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948801"
FT                   /orf_name="Pc16g04950"
FT                   /product="Putative uncharacterized protein Pc16g04950 "
FT                   /protein_id="CAP93165.1"
FT                   /db_xref="UniParc:UPI0001831A54"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9A5"
FT                   /transl_table=1
FT                   /translation="MGRYPETRVSMHDLINKGKPTLEAKKIDLGCEGLGHAAWGCGAVD
FT                   MFLRRGNCLSPPCFEVIRGLIDMFKSCRHIYSHVMIYSVSCSSRNAYKWMCGYHFLFSS
FT                   RKALAQSLIQPTHYTTTDMYYKASPAPLKDYRRGCSDCTTGLGEYVIVTGVWPACTTSI
FT                   VHTCRGQSHSEGTTYQFVPLSRRDRFNCMRVHGLVSLSHADIEMVFWSDYYCMKSPRPR
FT                   VCMDVFMMGTIQGVKAVANMGIT"
     atgggaaggt atcctgaaac cagggtctct atgcatgacc tgattaacaa aggcaaaccg        60
     acactcgagg ctaaaaagat agacctcgga tgtgagggct taggccacgc agcgtggggc       120
     tgtggagctg tggatatgtt tctgagacgt gggaactgtc tcagtcctcc gtgttttgaa       180
     gtgattaggg gattaatcga tatgttcaag agttgtagac acatatactc tcatgtcatg       240
     atctactccg tgagctgttc cagtagaaat gcatataagt ggatgtgtgg ctaccacttc       300
     ctgttcagct cccgcaaagc tctcgcccaa tctctaattc agccgacgca ttacaccact       360
     acagatatgt actacaaagc cagccccgcc ccgctgaagg attatcggcg gggatgcagc       420
     gattgcacaa caggactagg agaatatgta atcgtaactg gtgtgtggcc agcatgcacg       480
     acatccatag tgcatacatg caggggacag tctcactctg aaggaactac ataccagttc       540
     gtgccgctta gccggcgaga ccgattcaat tgtatgagag tacatggtct ggtttcgtta       600
     tcacacgcag atatcgaaat ggtattctgg tctgattatt attgcatgaa gtccccaagg       660
     ccacgggttt gcatggatgt tttcatgatg ggaacgatcc aaggtgtcaa agcagtggca       720
     aatatgggaa tcacttga                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page