(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE496

PENCW_13.PE496       Location/Qualifiers
FT   CDS_pept        1170386..1172512
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207951" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671911"
FT                   /orf_name="Pc16g04960"
FT                   /product="Pc16g04960 protein"
FT                   /protein_id="CAP93166.1"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniParc:UPI0001831A55"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9A6"
FT                   /transl_table=1
FT                   /translation="MTGPKPRTKIEGDCSTIHSNTFYVYSPTGFASIPLKENADWNSLP
FT                   SPEHMVTGPACVQGGAGEDEAFYLVGGTGSDGNSGLQRFSFSTQKWETLLMRSADMKDR
FT                   TGHGAGYIPSTSQILVYAGNTDGSTQISQSTLLISTKAPFDIESGVPQGEPALYEPIIL
FT                   PWSSSEVALIGGSATNTAIFIYQTANKQGWTISEATLPSAIQSNSLCALASDSGTKVLE
FT                   EFNMVASPNSVTSYLLSSKGKVQNPVTAIPSLEKRGLTDSYNDTFAPTASWSDYTLAQG
FT                   DGLVVLASGRSNDSLAIFNQTTNAWVNSTELFLGKGDQHVLKPSTTSLTSSTSTSTSSS
FT                   TSTSTSTAASTTPTSSSPVAAVAGGLTDHGKMILGATLGSILGFGLILLIILFLLRRAK
FT                   KKQQQTAQPGRGGDAKDRLSFQDQGIEPLTEGAYPMARSPVPLAAASTDSLAIMSGTYR
FT                   EKSLKPPANTGYGLSQPKASSPLSTIPSSGAMGASSVYTDDTSRAGDDTGHGNQAADRL
FT                   TDEGWGKYFEDGGATNFQSDRSTASSAYTKSDYRGSGWPMTTLTPLNFGFLDQPKPLGH
FT                   VLSGSPTTENGPSETGSRSLIIPESQSARISSADSISIASDDDRDDSKWQGAGQSSWLG
FT                   RPPSSNYTTSFYQASTQDMPWESSNGSLADKGRQSNARRSSVIIPHDIDELPVQGQQNN
FT                   TNSDMSWLNLKADR"
     atgactggcc ccaaaccccg aaccaagatc gagggcgatt gctccactat ccacagcaat        60
     accttctacg tctattcgcc gactggcttt gcatcaatac ctctcaagga gaatgcggat       120
     tggaactcac tcccatcccc agagcacatg gttactggtc ctgcctgcgt ccagggtgga       180
     gccggcgaag acgaggcatt ttatctggtc ggcgggaccg gctccgacgg caacagcggc       240
     ctccaacgct tttcgttcag tacacagaag tgggagacac tgctcatgag atcagcggat       300
     atgaaagatc ggactggaca tggcgcggga tacattccct caacttcgca aatattggtt       360
     tacgcaggaa acacagatgg cagcacacag atctctcaat cgacactcct catttcaaca       420
     aaagcgccct tcgacatcga gtctggggtc ccccagggcg aacccgcgct atatgagccc       480
     atcatcttgc cttggagttc ttccgaggta gccttgattg gaggctctgc cacgaatact       540
     gctatcttca tctatcaaac cgcgaataag caaggctgga ccatctccga ggcgactctt       600
     ccctctgcaa tccaatccaa ttctctatgc gcgctcgcct ccgattctgg gactaaggtc       660
     ctcgaagagt ttaacatggt cgcctcccca aatagtgtca ctagctacct ccttagctcg       720
     aaaggaaagg tgcagaatcc ggtcacagcc atcccatcct tggaaaagag gggtctcacc       780
     gattcttaca acgacacgtt cgcgccgaca gcatcctggt ctgattatac actcgcgcag       840
     ggtgacggct tggtagttct cgccagcggc cgaagtaacg actcattggc aatcttcaac       900
     cagactacca acgcatgggt caactcaaca gagctgttcc ttggaaaagg agatcagcat       960
     gtcctcaaac catccaccac atcactcaca tcatctacct cgacatcaac ctcgtcatcc      1020
     acatccacat ctacatcgac cgcggcctca actacgccca cttcgtcatc tccagttgcg      1080
     gctgtagctg gcggcttgac cgatcatggc aaaatgattc ttggcgcaac tctcgggagt      1140
     atcctagggt ttggcttgat cctgctcatc attctgttcc tactgcgacg cgcgaagaag      1200
     aagcaacaac agacagccca acccggtcgc ggtggcgatg ccaaagaccg cctaagcttc      1260
     caggaccagg gcatagaacc cctgaccgaa ggcgcttacc caatggcaag atctcctgtc      1320
     ccactcgcgg ctgcttcgac cgactcattg gctatcatgt ccggaaccta cagagagaaa      1380
     tccttaaagc cacctgctaa cacgggctat gggttgtctc agcccaaggc cagcagcccg      1440
     ctctctacaa ttccctcaag cggtgccatg ggcgcgtcaa gcgtatacac cgatgacacc      1500
     agtcgggctg gcgatgacac cggacatggg aaccaggccg ctgaccgatt gaccgacgaa      1560
     gggtggggga agtactttga ggacggcggt gccactaact tccaatccga ccgctcgact      1620
     gccagttccg catacaccaa gtccgactac cgcggaagcg gctggccgat gactacgttg      1680
     acaccattga atttcggctt cctcgaccag cccaagccac tcggccacgt tctcagcggc      1740
     agcccgacca cggaaaacgg cccatctgag acgggcagtc gaagcctgat aatcccggag      1800
     agccaatccg cacgaatctc cagtgcggat tcaatcagta tcgcctcaga cgacgaccgc      1860
     gacgattcaa aatggcaagg tgcaggccag agcagctggc ttggacggcc cccaagcagc      1920
     aactacacta ccagcttcta ccaggcgagc acgcaagaca tgccctggga atcatcgaac      1980
     ggaagcctcg cagacaaagg aagacaatcc aatgcacgac gatccagcgt catcatacca      2040
     catgacatcg atgaacttcc ggtgcaagga cagcagaaca ataccaattc agatatgagc      2100
     tggctcaatc tcaaggctga ccgttaa                                          2127
//

If you have problems or comments...

PBIL Back to PBIL home page