(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE497

PENCW_13.PE497       Location/Qualifiers
FT   CDS_pept        join(complement(1174959..1175733),
FT                   complement(1173175..1174901))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185420" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948802"
FT                   /orf_name="Pc16g04970"
FT                   /product="Pc16g04970 protein"
FT                   /protein_id="CAP93167.1"
FT                   /db_xref="UniParc:UPI0001831A56"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9A7"
FT                   /transl_table=1
FT                   /translation="MASSRESQHSLLSEDSIDTRPQRSWNPLNNRLTDSDYRYHSPSDS
FT                   TWSEEVLRDVGLGISNTSGDGIPAEIPTDKRHSTDSTATTTPNTYKIPHSPQTPQTPHT
FT                   HAHVRCPNRATVLQKRLSWVPLTVLILAVYATIFSGIYLGIALRKPRWQTVSSDGPLVP
FT                   STAALLSAFFAKTIELAYVTICVAFLGQVLSRRALMRDSRGISISDMNMRAWIMQPGSM
FT                   IVHWEALRYSALTFLGSIALVSTFVAMLYTTAAQALVAPKLSPGPVEPTILQGKVLSSF
FT                   ANTHYTAANCETPVTNEIDPDYRNTTCIQIEHVGHAYHNYQQWISQWSQLITHNNETSS
FT                   QLQKRPKPTGSLWDNTTVTGSWIDMQDMSTLSKEHGRMINNITMAMPHGGIPGAAMNSK
FT                   NKLKQPTDSSGEGKYTIEASVPSPAVNVLCTGMTKDELSPLVYSSWPGGDKFNMTTWTT
FT                   SPPDDIPDPASWLNRTVVDTLFQFGPKSDQIPPIFGKYPLPYNTILNTTGPWPANAIYL
FT                   LGATPPSNNTNTPEYVMCSLRAKQTGACSTKYSADMSGAFLSTDCENASNGLQYNRRHD
FT                   TPEGQWDADWKNIASEWANALSLNAGISDGAASNARLLMQMMPRYDKGEGAFALDPSLP
FT                   SIAEALAVMAGSTLILSSQNAPFVPFWNYSTENRNVLSEPVYQGFNASIQAFGYASGGT
FT                   EQWQGVFYVILVFAFLTSAVCLGFMIVEARGRQVTDFTEPQNLFALAVNSPQTTQLEGA
FT                   CGCGPWGEQLKERWYIGMEEEDEHYYIRSKTEEKIPLLKTMDSRQLEPMEIDDGGGRML
FT                   SPMVDEFRKVSKRHSFLAKLY"
     atggcctcgt cgcgggagtc gcagcactca ctgctatccg aagattcgat cgacactcgg        60
     ccccaacggt cttggaaccc actcaacaat cgcctaacag actcggacta tcgctaccat       120
     tccccctcag acagcacctg gtccgaagaa gtcctgcgcg atgtcggttt gggcatctca       180
     aacacatcgg gcgacggcat tcccgctgaa atcccgacag acaagcgcca ttcaaccgat       240
     agcaccgcga ctacgactcc aaatacctac aagattccac attctcccca gactccgcag       300
     actccacata cccacgccca cgtgcggtgt cccaaccggg caacggtgct tcagaagcga       360
     ctatcctggg tcccgttgac agtcttgatc ctcgctgtct atgccaccat cttttcaggt       420
     atctatctcg gcattgcgct tcgcaagccc cgatggcaga ctgtctccag cgatgggccc       480
     ttggtcccgt ctacagcagc tctgctgagt gcattctttg ctaagacgat cgagttggcc       540
     tatgttacga tttgcgtcgc gtttctggga caggtgctta gtcggagggc tttgatgagg       600
     gattctcgag gaattagtat ctcggatatg aatatgaggg cctggattat gcaacccggg       660
     tctatgattg tgcattggga ggcgttgcga tattcggcgc ttactttcct cgggtcgatt       720
     gcgttggttt cgacgttcgt tgcgatgctg tacaccactg cggcgcaagc tttggttgct       780
     cccaaactct ctcctggtcc tgttgaacca acgatactcc agggcaaggt actctccagt       840
     ttcgcaaaca cccactacac tgcagcgaac tgtgagacac ccgtcaccaa cgaaattgac       900
     cctgattatc gcaacacaac ctgcatccag attgaacacg tcggccacgc atatcataac       960
     taccagcaat ggataagcca gtggagccag ctaataaccc acaacaatga aacctcaagc      1020
     cagctccaaa agcgcccaaa gccaacaggt tccctctggg acaacaccac agtaacaggc      1080
     agctggatcg acatgcaaga catgtccacg ctatccaagg aacacggccg aatgatcaac      1140
     aacataacaa tggcaatgcc acatggcggc atccccggcg cagcaatgaa ctccaaaaac      1200
     aaactgaaac aacccaccga ctcctccggc gaaggcaaat acaccatcga agcctccgtc      1260
     ccctccccag ccgtcaacgt cctctgcacc ggaatgacaa aagacgagct cagcccccta      1320
     gtctactcct cctggcccgg cggcgacaaa ttcaacatga caacctggac cacctcaccc      1380
     ccagacgaca tcccggatcc cgcatcctgg ctaaaccgca cagtcgtcga caccctcttc      1440
     caattcggcc cgaaatccga ccaaatcccc cccattttcg gcaaataccc actcccatac      1500
     aacacaatcc tcaacacaac aggtccctgg cccgcaaacg ccatctacct cctcggcgcg      1560
     acgccaccat ccaacaacac caacacaccc gagtacgtga tgtgctcatt gcgcgcgaaa      1620
     caaacaggcg catgctcgac caagtactcc gccgacatga gcggtgcctt cctcagcacg      1680
     gactgcgaga acgcctcaaa cgggctacag tacaaccgac gacatgacac accggagggc      1740
     cagtgggatg cagactggaa gaatatcgcg tcggagtggg cgaatgcgct cagtctgaac      1800
     gcgggcatct ccgacggcgc ggccagcaat gccagactgc tgatgcagat gatgccgcgg      1860
     tacgacaagg gcgaaggggc gttcgcgctg gacccgagtt taccgtctat tgccgaggcg      1920
     ttggcggtga tggctgggag cacgcttatc ctcagctcgc agaatgcgcc gttcgttccg      1980
     ttttggaact atagtaccga gaatcggaat gtgctttctg agcctgttta tcaggggttc      2040
     aatgcttcta tccaggcttt tgggtatgct tctggtggga cggagcagtg gcagggggtt      2100
     ttctatgtga ttcttgtgtt tgcgttcttg accagcgctg tctgtcttgg gtttatgatt      2160
     gtcgaggcgc gcggtcggca ggtgactgat tttacggagc cgcagaattt gttcgcgctt      2220
     gctgtgaata gtccgcagac gacacagttg gagggtgctt gtgggtgtgg gccttggggg      2280
     gaacagttga aggagaggtg gtatattggg atggaggagg aggatgagca ttattatatt      2340
     cggagtaaga cggaggagaa gattccgctt cttaagacga tggattcgag gcagttggag      2400
     ccgatggaga tcgatgatgg tggtgggagg atgctaagcc ctatggttga tgagtttagg      2460
     aaggtgtcga aacgtcattc ctttttggcg aagctctatt ga                         2502
//

If you have problems or comments...

PBIL Back to PBIL home page