(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE498

PENCW_13.PE498       Location/Qualifiers
FT   CDS_pept        join(complement(1179721..1180057),
FT                   complement(1178127..1179670))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207940" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128964"
FT                   /orf_name="Pc16g04980"
FT                   /product="Pc16g04980 protein"
FT                   /protein_id="CAP93168.1"
FT                   /db_xref="UniParc:UPI0001831B1E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9A8"
FT                   /transl_table=1
FT                   /translation="MAYYEDRRYREPRDRYARASYADPYDDPRGRYRRHERDSYVPRAS
FT                   TDSIEEVQRDYPPGSEYAYERPYSSRRPRRPVYENMRRASSVSGYDPYNDASYRSSGPR
FT                   RSRHHEDKRSRRPKYESDSSPSRSPPRHRRRKSFSEQALGALGLGGAASSASRGERGRG
FT                   RSPSRHRHRHRSYSRSPSDSRSPSRHRGGSKRDKSEQRIAQAARAALTAGAVEAFKQRK
FT                   EPGDWAGSKGKRVLTAAVTAGGTDGLVDKDPNKHEKRHVIESTLAGLAASHFVNGSRSQ
FT                   SRGRDGGRSSSGGLKNLAATGALAAAGKEIYDRYSKSRSRPRGRNDSRDSNEERGSHKR
FT                   SKSVSEYISKGMAALGLGEEEGRRDSRDRKEHHREHRPEHRDDRERRHRRGHRRDYSDS
FT                   DSDTDSDYYNRGSRRGKSSRDVGRHHSLDGTNPPPYAPTSASRGESGAHGHGSSSESDS
FT                   DLGDSSDEKKQRKKLKRDMLVTGGLASVATIHAAHSIYGSMEKRKERQKQLKEGEITPE
FT                   EARKHRMKANTKDAVSIGLAALGIKGAYSEWKEVMEKNKENTHFREECAQRAVKRERRR
FT                   ARSQGVPSRHHRWPDEIEYAPSTNDSRSDHGTFYRDGNPYGAHEAPQISY"
     atggcgtact acgaggatcg ccgttatcgc gagccgcgcg accgctacgc acgagccagt        60
     tacgctgacc cgtacgatga tcctcgtggt cgttatagac gacacgagcg agactcttat       120
     gtaccccgcg ccagcaccga ctcgatcgag gaagtccagc gcgactaccc cccaggctca       180
     gagtatgcct acgagcgtcc ttatagttca cgtcggccga ggcgacccgt gtacgaaaat       240
     atgcgccgtg cctcctccgt cagcggatac gacccataca acgatgcatc ttaccgaagc       300
     tccggtcctc gtcggtcaag acaccacgag gataaacgct cccgtcgccc aaaatacgag       360
     tctgattctt ctccaagccg ttctccaccc cgccacagac gtcgcaagtc gttcagcgag       420
     caagctctgg gcgcgctagg cctcgggggt gccgcttctt cagccagtcg cggagagcgt       480
     ggtcgcggtc gttccccgtc ccgccatcgc catcgccata gatcatattc aaggtcaccc       540
     tcggattcgc gaagccccag tcgccaccgc ggtggtagca agcgcgataa aagtgaacag       600
     cgcattgcac aggctgcccg cgccgccctg acagccggcg ctgttgaggc attcaagcag       660
     cgcaaagagc ccggtgactg ggccggctcg aaaggaaagc gcgttctcac tgccgctgtg       720
     acggctggtg gtaccgacgg ccttgtcgat aaagatccca acaagcacga gaaacgtcat       780
     gttatcgagt ccacgcttgc aggtctagct gccagtcatt tcgttaatgg ttcacgctca       840
     cagtctcgtg gccgagacgg tggtcgctct tcaagtggtg gacttaagaa cctcgctgct       900
     actggagctc ttgctgctgc aggaaaggaa atctatgatc gatactcgaa atcgcgttct       960
     cggcctcgcg gccgcaacga ttcccgcgac agtaacgagg agcgcggctc ccacaagcgc      1020
     agcaagagcg tttcggagta catcagtaag ggaatggccg ccctgggact tggagaggaa      1080
     gaaggccgtc gcgatagcag agaccgtaag gagcatcatc gggagcatcg tccggagcat      1140
     cgggacgacc gagagcggcg tcatcgccgg ggtcatcgac gcgactattc ggactcggat      1200
     tcagatacgg acagcgatta ttacaaccgg ggctcgagac ggggcaaaag ctcgagagat      1260
     gtaggtcgac accattcatt ggacggaaca aatccacccc cctatgcacc caccagcgcc      1320
     tcgcgcggtg aatccggtgc gcacggccac gggtcgagct ccgagagtga ttctgactta      1380
     ggcgacagtt ctgatgaaaa gaagcaacgg aagaagctga agcgggatat gctcgtgacg      1440
     ggaggtctag ccagtgtggc caccatccac gctgcgcaca gtatctacgg gagcatggag      1500
     aagaggaaag agcgacagaa gcagttgaag gagggggaga ttacgcctga ggaggcccgc      1560
     aaacaccgca tgaaagctaa caccaaggac gctgtgagta tcggtctcgc tgcattaggt      1620
     atcaagggtg cctatagcga atggaaggag gttatggaga agaacaagga aaatactcat      1680
     ttccgggagg aatgcgctca gcgcgctgtt aagcgtgagc gtcgtcgcgc tcgtagccag      1740
     ggtgtgcctt cccgtcacca tcgctggccc gatgagattg aatacgcgcc ttcgacgaac      1800
     gattcccgga gcgaccatgg cactttttac cgtgatggaa acccttacgg ggctcatgag      1860
     gcaccgcaga tctcttacta g                                                1881
//

If you have problems or comments...

PBIL Back to PBIL home page