(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE499

PENCW_13.PE499       Location/Qualifiers
FT   CDS_pept        complement(1181140..1181949)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207929" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948803"
FT                   /orf_name="Pc16g04990"
FT                   /product="Pc16g04990 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP93169.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001831B1F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9A9"
FT                   /transl_table=1
FT                   /translation="MSSCRASIVSILNNDDNPSFAVRSAPRLSRNHTSPSYYPHHSETL
FT                   PPPVSDPQFTRPQASSESPATSPRGTRHPSDAMTEVVQPVSPGSSDGSAYDYITSQPSS
FT                   YHPYTRQDPRREPYRFSARGPAAPRTPPETRSSTSERPSSQTGATRGTGRKNKYPCPYA
FT                   VSHGCSSTFTTSGHAARHGKKHTGEKSVLCPICNKAFTRKDNMKQHIRTHRTHSDEMRS
FT                   TSEPESDARWAMGRLGSAYASASHQLNASQPMEAGVPPVPGAGPQAP"
     atgtccagct gtagggcgag tattgtgtcc attctgaata atgatgacaa cccatctttt        60
     gcggtccgtt ccgctccccg actcagtcgg aaccacacat caccatcata ttatccacat       120
     cattcagaga cactcccccc gcccgtcagc gacccacagt tcacccgtcc ccaagcttca       180
     tccgaatctc cagcaacatc accacgaggg accagacacc cctcggacgc gatgactgaa       240
     gtcgtccagc ccgtctcacc cgggtcatcc gacggctcag cttacgacta tatcaccagt       300
     cagccatcat cttatcaccc gtatacccgg caggatccgc gacgggaacc ataccgattc       360
     tctgctcgcg gcccagcagc gcctcgaaca ccaccggaga ctcgttcgag cacatccgaa       420
     aggccttctt ctcagaccgg tgcgacgcgc ggcacagggc gcaagaacaa gtacccgtgt       480
     ccctatgccg tgagccatgg atgctcttcc acgtttacga cgtcgggtca tgcggcgcgc       540
     cacgggaaga agcacactgg cgaaaagagt gtgctctgtc ccatctgtaa caaggccttt       600
     acgaggaaag acaatatgaa acagcacatc cggactcacc gcacgcactc ggatgagatg       660
     cgctctactt cggagccgga gtctgacgct cgatgggcga tgggtcgtct cggttcggcc       720
     tatgcctcgg cttctcacca gctcaatgcc agtcaaccta tggaggcagg tgtaccgcct       780
     gtcccaggcg ctggccctca agcgccctaa                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page