(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE50

PENCW_13.PE50        Location/Qualifiers
FT   CDS_pept        join(complement(108693..108823),complement(108292..108629),
FT                   complement(108073..108243),complement(107605..108001),
FT                   complement(107398..107550),complement(107077..107347))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169242" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671093"
FT                   /orf_name="Pc16g00500"
FT                   /product="Pc16g00500 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP92720.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000183115A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U9"
FT                   /transl_table=1
FT                   /translation="MADQDIFDEKHRIGEQVNDSPPSESELDHIVKDWDVEESAVRRKV
FT                   DFILIPILAVAFFALQMDRGNISAVLTSTITKDLNITTNQINIGSQLLSAGIVLSEIPS
FT                   NIIMQRIGPRVWLSGQLFAWGLVATFQAFVQSYPGYLVTRILLGFCEGGFIPGALYYLS
FT                   TWYKKDETSLRTSLFFYGQMFASATSSLISAGLLQLNGTHGMEGWRWIFLVEGLITLFI
FT                   AIVFTLLVPPSAGDGRPLIAFGRWSYFTERESHIIRNRVLLDDPLKAKGHIQISGSDIW
FT                   QTIKQPRILQHVFVTLVAMSGFSGLTQYTPSMIKSLGFGAVRANALASVPVYCSMIWLI
FT                   GLSFAADKTTHRGPFVLLAITWNVISYACLRTSNPHDSQWHRYGVIAVANISYCSMHIL
FT                   NVGWLSFYCRTPQERSVAMALVVMAANCAGIAGSQIFRTSDAPKYLHGLTAICSIAGAS
FT                   WILTFVLCVQYYFRRQKAVSSDTAEAKP"
     atggcagacc aagatatctt cgatgagaaa cacagaatag gcgagcaggt caacgactca        60
     cctccgagtg agagtgagct tgaccatatc gtcaaagact gggatgtgga agaatcggcc       120
     gttcggagaa aggtcgactt tatcctcatc cctattctag cagtcgcctt tttcgccttg       180
     cagatggatc gcgggaatat tagcgccgtc ttaacatcga ccatcactaa agacctcaat       240
     atcacaacaa atcaaattaa tatcggatca cagctgctgt cagcgggcat tgttctctct       300
     gaaattccat cgaatattat tatgcagcga ataggacccc gtgtctggtt gtcggggcag       360
     ttgttcgcct ggggcttggt tgctaccttc caggcttttg ttcagtcgta tcctgggtac       420
     ctggttacga gaattctgct aggattctgc gagggcgggt ttattcctgg cgctctatac       480
     tacctttcca cctggtataa gaaggatgag actagtcttc gcaccagtct tttcttttat       540
     gggcagatgt ttgcatcggc tacatccagc ttgatatcag ctggtcttct gcagctgaac       600
     ggcacccatg gtatggaggg atggagatgg atcttcctgg tcgagggctt gataaccctc       660
     ttcattgcaa tcgttttcac tctccttgtg cctccatcgg ctggagacgg gcgtccattg       720
     atcgctttcg ggcgctggag ttacttcacc gagcgcgagt cgcacatcat ccgcaaccgc       780
     gttctgctag atgaccccct caaggccaaa gggcatatcc agatttccgg ctctgatatt       840
     tggcagacca tcaagcaacc acgcatcctg caacacgttt ttgtgacctt ggtggccatg       900
     tctggcttct cgggtctaac ccaatacact cccagcatga tcaaatcgct gggcttcggt       960
     gccgtcaggg caaatgcatt ggcttctgtt cctgtatact gtagtatgat ctggctgatt      1020
     ggtctgtctt ttgctgcaga caaaacgaca caccgcggac cctttgtgct cctggctatc      1080
     acttggaatg tgatttcgta cgcttgtctt cgaacgagta accctcacga ttcccaatgg      1140
     caccggtacg gcgtcattgc cgtcgctaac atctcgtact gcagcatgca tatcttgaat      1200
     gtcggctggt tgtcattcta ctgccgaaca ccccaggaac gaagtgttgc catggcgttg      1260
     gtggtcatgg ctgctaactg tgctggtatc gctgggtcgc agattttccg cacttccgat      1320
     gccccaaagt acttacatgg tctcactgca atctgctcga tagctggtgc ctcgtggatc      1380
     ctcactttcg ttctttgtgt tcagtattat ttccgccgac aaaaggctgt ttcttcggat      1440
     actgcagagg cgaaacctta a                                                1461
//

If you have problems or comments...

PBIL Back to PBIL home page