(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE501

PENCW_13.PE501       Location/Qualifiers
FT   CDS_pept        join(1185347..1185482,1185526..1185652,1186115..1186208,
FT                   1186341..1186534,1186664..1186739,1186828..1187061)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128965"
FT                   /orf_name="Pc16g05010"
FT                   /product="Putative uncharacterized protein Pc16g05010 "
FT                   /protein_id="CAP93171.1"
FT                   /db_xref="UniParc:UPI0001831B21"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9B1"
FT                   /transl_table=1
FT                   /translation="MGPVPKLLRLSLSGDAQYSVNLRRFAKVETPAYKAEGNDPEWTHY
FT                   DQIIPDNSPRSKNQVPYGLSATPGITLGYRQTLASLVRLDIDRHMWLRQGAVHTWMFER
FT                   GQSITMTPVLLYAVKACCCVHARMPSKREITSNIRRLAPAYSGGEADEIWRLPKDVGSP
FT                   GDFSREIHRAERTSEYVEGGVFWITSTMVGLHIVAKCVDMTIADASNANKMGDLGASRK
FT                   SFGAQSEKYHAPATSTLVSSCPLSLLLSYSLVNEQNPYNGANFFHQGTWYGPQICRGNT
FT                   LVSPC"
     atgggacctg tgcccaagtt attgaggctt tcactgtctg gagatgctca atattctgtc        60
     aaccttagaa ggtttgccaa ggtcgaaacc cctgcttaca aagcggaggg aaatgacccc       120
     gagtggactc attatgacca gataatccct gataattcac ctcgctccaa aaatcaagtc       180
     ccttatggtc tgagcgcgac cccaggtatc actttaggct accgtcaaac cctagcttcc       240
     ttagttcgat tggatattga ccgtcatatg tggctgagac aaggcgcagt tcatacttgg       300
     atgtttgaac ggggtcaatc cataacaatg actcctgtac tcctgtacgc agtcaaggct       360
     tgctgctgcg tgcatgctag gatgccaagc aaaagggaaa ttacttcaaa cattcgtagg       420
     ttagcccctg catattcggg tggggaggcc gatgagatat ggcggctacc taaagacgtt       480
     gggagtcccg gagacttttc gcgggaaatt caccgagcgg agaggacgag tgaatacgtg       540
     gagggtggcg tgttttggat aacgtccacg atggttgggc tgcatattgt agccaagtgt       600
     gtcgacatga ctattgctga tgcgtcgaac gctaacaaga tgggagacct aggggccagc       660
     aggaaaagct tcggtgctca atctgagaag tatcatgccc ccgcaacatc gactcttgtc       720
     tcatcatgcc cactttccct tctactatct tatagtctag ttaacgagca gaatccatac       780
     aatggagcga acttcttcca tcaaggtact tggtatggcc ctcaaatatg ccgtggaaac       840
     acattagtga gtccgtgctg a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page