(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE503

PENCW_13.PE503       Location/Qualifiers
FT   CDS_pept        join(complement(1190086..1190330),
FT                   complement(1189452..1190023),complement(1188868..1189394))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160947" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948805"
FT                   /orf_name="Pc16g05030"
FT                   /product="Pc16g05030 protein"
FT                   /function="acyl-CoA dehydrogenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP93173.1"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="UniParc:UPI0001831B22"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9B2"
FT                   /transl_table=1
FT                   /translation="MDREGKEETEGERLSGTIYLWWHHVMSRDPPNIMPPAAPVKGFRR
FT                   VGIVFARLIVSGEDRGIRPFITWLSDGEHMCDGVTAKLLPRRAASKPVDHAITTFTHVR
FT                   LPKSALLGSLDKPKDMRKEFLSSIWRIRVGSVALPLQMIAGMKRGVFVAGKYSQRRHIF
FT                   GPDQKPKPIISFRTQHGPILHALAQLSVFDAYAQHSIQYFKHPNVAAPVQHAIGAMLKA
FT                   VLYKTSQACLFTLSERCGAQGLFENNHIIEAMLETRAMSIAEGDTLVLSIRLTSEILLN
FT                   RYNMPPAKDPTSLLAKHEQGLLDELRGMTRTISGGHRGEGFDRLVLPRSQEFVEAMGHR
FT                   IAYEAAIEAGVHSDLVALYEIWVILQNQGWFVQHTSLTRERMFQVEADRLSVVLPQLDT
FT                   LLDATGAEPYCSAPIASQASWDHFVDQLETKTGSRTTNIDLLRGGAML"
     atggacagag agggaaaaga agagactgaa ggtgagaggc tgtctgggac tatctacctg        60
     tggtggcatc acgtgatgtc acgtgatcca cccaacataa tgccaccagc tgcgccagta       120
     aagggtttcc ggcgagttgg aattgtcttc gcccgactta ttgtttccgg tgaagatcgt       180
     ggtatcagac cctttatcac ttggctcagc gatggagagc atatgtgcga cggtgtaacc       240
     gctaagctgc tccccagacg agcagcatca aagccggtag atcatgccat tacgactttt       300
     actcatgtcc gcctacccaa gtccgccctc ttaggaagcc tggataaacc gaaagatatg       360
     cgaaaggagt ttctatcatc gatctggcgc atcagggttg gtagtgtcgc gttgccacta       420
     cagatgattg cagggatgaa acggggtgtt ttcgtcgcag gaaagtatag ccagcgtcgg       480
     catatatttg ggccagacca gaaacctaag cccattatct ctttccggac tcaacatggt       540
     cccatactgc atgcattggc tcagctctcc gttttcgacg cctatgctca gcatagcatc       600
     cagtacttca aacaccccaa cgtggcagcc ccggtccaac atgcgattgg ggctatgttg       660
     aaggctgttt tgtacaaaac atctcaagcc tgtcttttta ctctctccga gcgatgcgga       720
     gcgcagggtt tatttgagaa caatcatatt attgaggcca tgttggaaac ccgtgcgatg       780
     tcgatcgccg agggagatac cctagtgttg agtattcgat tgacatcgga gattctcctc       840
     aatcgataca acatgccgcc tgcaaaggac ccaacctccc ttttagcaaa gcacgaacaa       900
     ggactacttg atgagcttcg cgggatgacc aggaccattt caggaggcca ccgcggagaa       960
     ggttttgacc ggttggtctt gccaagatcc caggaattcg tcgaggctat gggacatcgc      1020
     atcgcctatg aagccgctat agaggcagga gttcattctg acttagtggc actgtatgaa      1080
     atctgggtca tattgcagaa tcagggctgg tttgtccagc atacgagtct aacccgggag      1140
     cgcatgttcc aggtagaagc agatagactc agcgttgtgt tgcctcagtt ggatacgttg      1200
     ctggacgcta ctggcgctga gccgtactgc agtgcgccta ttgcatccca ggcatcatgg      1260
     gaccatttcg tcgaccagtt ggagaccaag acaggaagtc gtactacaaa catcgatctc      1320
     ttaaggggcg gggccatgct gtaa                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page