(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE506

PENCW_13.PE506       Location/Qualifiers
FT   CDS_pept        1198057..1199211
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000050844" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671912"
FT                   /orf_name="Pc16g05060"
FT                   /product="Pc16g05060 protein"
FT                   /function="coenzyme binding"
FT                   /function="hydroxymethylglutaryl-CoA reductase (NADPH)
FT                   activity"
FT                   /biological_process="coenzyme A metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP93176.1"
FT                   /db_xref="GO:0004420"
FT                   /db_xref="GO:0015936"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="UniParc:UPI0001831B23"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9B4"
FT                   /transl_table=1
FT                   /translation="MASKTMAKFAHVLQDAKHITERVHDAPEISIENFIGYISVPVGLA
FT                   GPLLIKSPDGTSTRTYAPIATTESAIIASCSRGCKALNESGGGQFHVLSEAMSRSPVFQ
FT                   FNCTEHAIDFARRVPDLWDYIAKTAKSTSRHARLVKLTPNIVGSNVHVRFDYTCGDAAG
FT                   QNTVTIATQRVCDWLLASSQEMELHITGVFIEGNMAPDKKPSWGTVSSPRGVEVVTWAS
FT                   LSDEVCRAVLKCTAENLYHAFRTTQEGGIRNGQFGSNINVANVITGIFIATGQDAASVA
FT                   EGPFGHLTPEYDHKSRQVKLTLYFPSLPVGTVGGGTAYKTQREALGILGCSGSGMKPRL
FT                   AGLIAAFSLALEISTAAAAATNTFTQSHERLARAKQGNNPASKI"
     atggcttcaa agacgatggc aaagtttgca catgtcctcc aagatgcaaa acatataact        60
     gaacgcgtac acgatgcacc ggaaatatct attgaaaact tcatcggata tatctccgta       120
     ccggttggtc tagcgggtcc tctgttgatc aaaagccctg atggcaccag taccagaacc       180
     tacgctccaa ttgctaccac agagtccgcc atcattgcaa gctgcagcag aggctgtaag       240
     gctctgaatg aatctggtgg aggccagttt catgttctga gcgaagcaat gtctcgcagt       300
     ccagtctttc aattcaattg taccgaacat gcaatcgact ttgcccgtcg cgtgccggac       360
     ctctgggact atatcgccaa gaccgcgaag tccacaagcc gtcatgctcg tcttgtgaaa       420
     ttgacaccga atatagtggg ttccaatgta catgtgcggt ttgactacac atgtggagat       480
     gccgcaggcc agaatacggt cacgattgct actcagcgtg tttgtgattg gcttcttgct       540
     tcctcgcagg agatggagct gcacatcacc ggtgtcttca ttgaaggcaa catggcaccg       600
     gacaaaaagc catcgtgggg aactgtcagc tcgcctagag gtgttgaggt tgtcacatgg       660
     gcctcacttt ccgacgaggt atgccgtgcc gttctcaagt gcacggccga gaacctgtac       720
     cacgctttcc gcacaacaca agagggaggg attcgaaacg gtcagttcgg atctaatata       780
     aacgtggcaa acgtcatcac tgggatcttc atcgcgactg gccaggacgc tgcatcggtt       840
     gctgaagggc cctttggcca cttgaccccg gagtatgatc ataagtctcg tcaggtgaaa       900
     ttgaccctct atttcccatc tctaccagtt ggcacggttg gaggtggaac cgcatacaaa       960
     acgcagcgag aggctctcgg cattttggga tgcagtggtt ctggtatgaa accccgttta      1020
     gcgggtctga ttgctgcttt ttctctcgcg ctggaaatca gtactgcagc ggccgcggca      1080
     accaacactt tcacccaaag ccatgagaga ctagcacgtg caaagcaagg aaataaccca      1140
     gccagtaaga tttga                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page