(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE507

PENCW_13.PE507       Location/Qualifiers
FT   CDS_pept        join(1199924..1200552,1200606..1200762,1200936..1200962)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948806"
FT                   /orf_name="Pc16g05070"
FT                   /product="Putative uncharacterized protein Pc16g05070 "
FT                   /protein_id="CAP93177.1"
FT                   /db_xref="UniParc:UPI0001831B24"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9B5"
FT                   /transl_table=1
FT                   /translation="MSREVDIVPLIGHCVPYVAIILYHTRRQVRIYSTTFSKHKAFLFI
FT                   HIGTGIMELARYHISKARLGNENVLPEVIDVLSCLIWSWASFVLVKTLRRGDPLTTRPP
FT                   YQVAAALRPVICIASYMLQLPSLHRISISALDSFVYARMAIFFFTYTPYLRGYSYSTIY
FT                   SLSIPLAAVVSIHESHVRGATLVFMLATAYVAKLNEWVTHRSRIVQRSETKSAMDMLEK
FT                   HVLAGLLLLGFAELDRLREVSKNDALTKPLNDDYVPKLEHVFIYKVRS"
     atgtcccgtg aagtcgatat cgtaccgttg atcggccatt gcgttccata cgtagccatc        60
     atactctatc atactcgacg gcaggttcga atttatagca cgacattctc caagcacaag       120
     gcctttctct tcatacatat tggcactggc atcatggaat tggctcgata ccacatctcc       180
     aaagcccgac ttggcaatga aaatgtcctc cctgaggtaa tagacgtgct gtcttgtctc       240
     atctggtctt gggccagttt cgttctcgtg aagacgctcc gccgcggcga tccacttaca       300
     actcggccac cttatcaggt tgctgcagct ttgcgcccgg taatctgcat cgcatcgtac       360
     atgctccaat tgcccagcct acacagaata tctatctctg cgctcgacag cttcgtttat       420
     gcccgaatgg cgatcttttt cttcacctac acgccgtatc tacgcggata ctcgtacagc       480
     acaatctact cgctctctat tccactggca gctgttgtga gtattcatga aagtcacgtt       540
     cgcggcgcaa ccctagtctt catgcttgca acagcctacg tcgcaaaatt gaatgagtgg       600
     gtgacgcata ggtcaaggat cgtgcagcga tccgaaacga agtcagctat ggatatgctc       660
     gaaaaacatg tcctcgccgg tctactcctt cttgggttcg ccgagctaga caggctacga       720
     gaagtttcca agaacgacgc gctcacgaag cccctcaatg acgactatgt accaaagttg       780
     gaacatgtgt tcatttacaa agttcgttca taa                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page