(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE508

PENCW_13.PE508       Location/Qualifiers
FT   CDS_pept        join(1201755..1201793,1201848..1201980,1202031..1202157,
FT                   1202219..1202820,1202878..1203323)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000227987" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948807"
FT                   /orf_name="Pc16g05080"
FT                   /product="Pc16g05080 protein"
FT                   /function="adenosylhomocysteinase activity"
FT                   /function="binding"
FT                   /biological_process="one-carbon metabolic process "
FT                   /protein_id="CAP93178.1"
FT                   /db_xref="GO:0004013"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006730"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="UniParc:UPI0001831B25"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9B6"
FT                   /transl_table=1
FT                   /translation="MAAPAQKFKVADLSLAAFGRREIELSEVEMPGLMAIREKYGADQP
FT                   LKGARIAGCLHMTIQTAVLIETLTHLGAEVTWTSCNIFSTQDHAAAAIAAAGVPVFAWK
FT                   GESEEEYQWCLDQQLQAFKDGKKLNLILDDGGDLTSLVHTKYPEMLDDCFGVSEETTTG
FT                   VHHLYKMMKENTLKVPAINVNDCVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVA
FT                   GYGDVGKGCAQALHSMGARVIVTEVDPINALQAAVQGYEVNTMEAAAPIGQIFVTTTGC
FT                   RDILVGRHFEAMRNDAIVCNIGHFDIEIDVAWLKANSQSVQNIKPQVDRYSLNGKNIIL
FT                   LAEGRLVNLGCATGHSSFVMSCSFSNQVLAQIALFKAEDEAFGKKYIEFGAGGRKPVGV
FT                   YVLPKQLDEQVARCHLDHVNAKLTELTPVQAEYLSLPVNGPFKPEIYRY"
     atggctgccc ccgcacagaa gttcaaggtc gctgacctct ccctggccgc tttcggtcgc        60
     cgcgagatcg agctctccga ggttgagatg cccggtctca tggccatccg tgagaagtac       120
     ggtgccgacc agcccctcaa gggtgcccgt atcgccggtt gtcttcacat gaccatccag       180
     accgccgtcc tcatcgagac cctcactcac ctcggtgccg aggtcacctg gacctcttgc       240
     aacatcttct ccacccagga tcacgccgcc gccgccattg ccgccgccgg tgtccctgtc       300
     ttcgcctgga agggtgagtc tgaggaggag taccagtggt gcttggacca gcagctccag       360
     gccttcaagg atggcaagaa gctcaacctc atccttgatg acggtggtga cctcacctcc       420
     ctcgtccaca ccaagtaccc cgagatgctc gatgactgct tcggtgtctc cgaggagacc       480
     accactggtg tccaccacct gtacaagatg atgaaggaga acaccctcaa ggttcccgcc       540
     atcaacgtca acgactgtgt caccaagtcc aagttcgaca acctctacgg ctgccgtgag       600
     tcccttatcg atggtatcaa gcgtgccacc gatgtcatga tcgctggtaa ggtcgctgtc       660
     gttgccggtt acggtgatgt cggtaagggt tgtgcccagg ctctccactc catgggtgct       720
     cgtgtcattg tcactgaggt cgaccccatc aacgccctcc aggctgccgt ccagggttac       780
     gaggttaaca ccatggaggc cgctgcccct atcggtcaga tcttcgtcac caccactggt       840
     tgccgtgaca tccttgttgg ccgtcacttc gaggccatgc gcaacgacgc cattgtctgc       900
     aacatcggtc acttcgatat tgagattgac gtcgcctggt tgaaggccaa ctcccagtcc       960
     gttcagaaca tcaagcccca ggttgaccgt tacagcctca acggcaagaa catcatcctc      1020
     cttgccgagg gtcgtcttgt caaccttggc tgcgctaccg gccactcttc cttcgtcatg      1080
     tcctgctctt tctccaacca ggtcctggcc cagattgccc tcttcaaggc tgaggatgaa      1140
     gccttcggca agaagtacat cgagttcggt gccggtggcc gcaagcccgt cggtgtctac      1200
     gttctgccca agcagctcga cgagcaggtc gctcgctgcc acttggacca cgtcaacgcc      1260
     aagcttaccg agctgacccc cgtccaggcc gagtacctca gcttgcccgt caacggtccc      1320
     ttcaagcccg agatctaccg ttactaa                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page