(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE510

PENCW_13.PE510       Location/Qualifiers
FT   CDS_pept        join(complement(1206674..1207477),
FT                   complement(1205736..1206626))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824618"
FT                   /orf_name="Pc16g05100"
FT                   /product="Pc16g05100 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP93180.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001831B27"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9B8"
FT                   /transl_table=1
FT                   /translation="MSLYPNRHRLALFSLKPLNEQAKKVANHPYNQHLTSSLPDGTRVL
FT                   DIGFQVRSRSNRTLATLGRGDADIFVDGPTIAKVQCSFEIEPATNVVMLYDRSHGQTTQ
FT                   VFGDDATPFEPGRLRQVVVQKGLNSFLGMGGRAQNTVQFEFLWYQDFPEMVGLIKDRES
FT                   IMNDCEENPRLARTADDVETVLPSQMQTRIHTAGPRQLTMRYLKFGKLGSGQFAVVYKA
FT                   LDVDTGKFLAVKIIQRPEQASAQAAWEVSKYYALKREVEHLSRISHPHIVDFITSQGWE
FT                   GPTAEIFMGLKDGTLESLVKGGVPDVESIAKRAFYQMLQALDCLAANGIVHRDVKPENI
FT                   LYTVLPGMQYHFQLGDFGLSNRAIVAKSSVGTPLYMAPEVYEHGVQTHKMDVWSLFVTF
FT                   AWVSDFDGFRQNLHHFTSLPQAREAILAMASRIGAMQEMARVNPDERASAAQILVKVYN
FT                   GEGLTTQLNRIPPLTPTVVETRPEPQLQPEPMHQVRHRPTQGMPKFPKPHTSQFRVRKS
FT                   SNPRGRIWEPNTTAARPGGNLPPTRRRRHPSNVEFLQGFRMRPPLNY"
     atgtcgttgt atccaaaccg ccatcgcctt gcactcttct ccctcaagcc cttgaacgaa        60
     caagccaaaa aggtcgccaa tcacccttac aaccagcacc ttacttcgag cttgcctgat       120
     ggtacacgcg tccttgacat cggcttccaa gtacggtcac ggtcgaatcg cacacttgca       180
     acactaggac gtggggatgc agacatcttc gtagatggcc ccaccatcgc gaaggtccag       240
     tgctctttcg agattgagcc ggccaccaat gtggttatgc tctacgacag gtctcatggt       300
     cagacaacac aggtttttgg cgacgatgcg acgccattcg agcctgggcg tcttcgtcaa       360
     gtagttgtcc agaagggctt gaacagtttc ctgggtatgg gcggcagagc acagaatacc       420
     gttcaattcg agtttctgtg gtatcaagat ttccccgaaa tggtggggct gatcaaagat       480
     cgagagtcta ttatgaatga ctgcgaggaa aatccgcgcc tagctcggac ggcagacgac       540
     gtggaaacgg ttttaccgtc ccaaatgcag actagaatcc acactgccgg ccctcgccag       600
     ctgacgatga gatacttgaa gttcggaaaa cttgggtctg gacaatttgc agttgtatac       660
     aaggccctcg atgtcgacac gggcaaattt ctcgctgtca agataatcca acgacctgag       720
     caagcttcag cacaggcagc gtgggaagtg tcaaaatact atgcattgaa acgcgaggtc       780
     gagcatttgt cccgcattag ccacccacat atcgttgatt ttatcacctc ccagggctgg       840
     gaaggaccaa ctgcggaaat attcatgggc ctcaaagacg gcacacttga atctttggtc       900
     aaaggtggag ttccggatgt agagagtatc gccaaacgtg ccttctacca aatgcttcag       960
     gcgttagatt gcctagctgc gaatggcatt gttcatcgag atgtcaagcc agagaacatt      1020
     ctttatactg tactaccggg tatgcagtat cactttcagc ttggcgattt cggtctatcc      1080
     aatcgcgcta ttgttgctaa gagctctgtc gggacgccgt tgtacatggc ccccgaagtt      1140
     tatgagcatg gagtccagac acacaagatg gacgtctggt ctctttttgt aacattcgca      1200
     tgggtatcag attttgatgg atttcgtcaa aacttgcacc atttcacgtc cctgccacag      1260
     gcccgcgaag ccatcctcgc tatggcatca aggatcggag cgatgcaaga aatggcaaga      1320
     gtcaatcccg acgagcgggc ctccgcggca caaatactgg tcaaggtcta caacggcgaa      1380
     ggcctcacaa ctcaactgaa tcgcatccca ccactcactc caacagtggt ggaaaccaga      1440
     cccgagccac agttacaacc agagcccatg catcaagtca gacatcgacc aacccagggt      1500
     atgccgaagt ttccaaaacc gcacacgagt cagttccgtg tccgtaagtc gagtaatcca      1560
     cggggtcgaa tatgggagcc gaacaccaca gctgctaggc ctggaggaaa tcttcctccc      1620
     acaaggaggc gtcggcatcc ctccaatgtt gaattcttgc aagggtttcg tatgcggccg      1680
     ccacttaatt actag                                                       1695
//

If you have problems or comments...

PBIL Back to PBIL home page