(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE511

PENCW_13.PE511       Location/Qualifiers
FT   CDS_pept        1207907..1209064
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824619"
FT                   /orf_name="Pc16g05110"
FT                   /product="Pc16g05110 protein"
FT                   /protein_id="CAP93181.1"
FT                   /db_xref="UniParc:UPI0001831B28"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9B9"
FT                   /transl_table=1
FT                   /translation="MADSIRSGLSNIHTALDNLVKNPRRLDIDRSRFDREASYISHQSH
FT                   NSTASMSPSGPSDTQNRRDLRKWQLSKDHEASRPYQQFEAQVNEMEASIIEGIERRTLN
FT                   VPDGTIMRVLARDTVKENWMKQGIWNEEWGKTPQMRWMHEPSPEITPEPETYPGARPLL
FT                   GLFAPLGGALPTDTGKNVRQGGERQPKQKTGDEPSRPFHQFIYQISKESERVRNLDARL
FT                   PTIFHDPEPPAANINTNAYERVKSIWVKRGIWNEEWGILPGMAWKHESPLQIPDDDCDS
FT                   MPSPVKPKAKVTFNIFQDLMPAQPDGPAPMGGQGTNKRKRAAAPVETKRTKRKVSKPAK
FT                   PEASSSRRAVGIPTNQNQVDVPDQGTRDTGRRRSKRIQNRTKSSK"
     atggcggaca gcatcagatc tggcctatct aatatccata ccgcgcttga caaccttgtt        60
     aagaacccca gacgacttga tattgaccgg tcacgtttcg acagagaagc atcatacatt       120
     tctcatcagt cgcacaattc aacagcatcc atgagtccca gcggcccttc cgacacgcaa       180
     aaccgacgtg atcttcgaaa atggcaactg agcaaggacc acgaagcttc acgcccttat       240
     caacaatttg aagcccaggt caacgaaatg gaggcctcca taattgaggg aatcgaaagg       300
     agaacactga atgtccccga cggtacaatt atgcgcgttc tcgcgcgaga cacggtgaag       360
     gagaactgga tgaaacaagg aatctggaac gaagaatggg ggaaaacgcc tcaaatgcgg       420
     tggatgcatg aaccatctcc tgagattact cctgagcccg agacataccc tggtgctaga       480
     ccccttcttg ggttgttcgc tccccttgga ggtgccttgc cgactgacac cggcaaaaat       540
     gtacgacagg gcggtgagcg acagcccaaa cagaaaaccg gggacgagcc atcgcgccca       600
     tttcatcaat tcatctatca aatatcaaag gagagcgaac gagtccgaaa tctcgatgct       660
     cgtcttccaa ccatatttca tgaccctgaa cctcctgctg caaatatcaa caccaacgct       720
     tatgagcgtg tgaaaagtat ctgggtcaaa agaggcattt ggaacgagga atggggcata       780
     ttacctggca tggcttggaa gcatgaaagc cctttgcaga ttccagatga cgactgtgat       840
     tcgatgccga gcccggtaaa gcccaaagcg aaagttacct tcaatatttt ccaggatctt       900
     atgcctgctc aaccagatgg tcccgctcca atgggtggcc agggaaccaa taagaggaaa       960
     agggccgccg ctcctgttga aacaaagaga acaaaacgaa aggtttccaa acctgccaag      1020
     ccggaggcat caagctcgag gcgtgcagtg ggtattccta ccaaccaaaa ccaagtggat      1080
     gtgcctgatc aagggactcg agatactggg agacgtagaa gcaagcgcat acagaatcgg      1140
     actaagagct ccaagtga                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page