(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE513

PENCW_13.PE513       Location/Qualifiers
FT   CDS_pept        join(complement(1213093..1213630),
FT                   complement(1212990..1213043),complement(1212659..1212932),
FT                   complement(1211752..1212568))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671913"
FT                   /orf_name="Pc16g05130"
FT                   /product="Pc16g05130 protein"
FT                   /protein_id="CAP93183.1"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniParc:UPI0001831B2A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9C1"
FT                   /transl_table=1
FT                   /translation="MLLSKTLLGSILGFAVSSTARIIATDEVPLLGPSFLSNFDPSNST
FT                   AISHAKSEFPGLIDNLFSTGALNRTDLAFHIDVFSASTNKSIYSYSHVGENSKKSVTSG
FT                   ELNDKTISRLGSVTKLFTVYAIIAKAGIEVFSDPVTKYLPELAGNPAYDPLESIRWEDI
FT                   TVGALASQQAGSGGAADFLKHYLDPERPLQYSAEDLLKFFRDEKKPVISPFRNAVYSDG
FT                   GFAILGQVLARLSGKTYSEAVQEILFDPLELESMSTKVPTGPDLNVIDRRIIDKNTSWG
FT                   VDVEVIASTGSYYSNAADLRTAGLAILNSELLSPATTSQWMKPSSGTGSLVELVGAPWE
FT                   ISRLEIPVTPGSNRTRISDLYTKAGGNIDYTAIFALSPDHGIGYSILVAGFTATPARWP
FT                   LRDVVGETFIPAAEHAAAENAKRNLAGTFADQTSPDTNLTLSVDRGRPGLGLKSFWVKG
FT                   TNARDHAHWRLYPTGLNSFSKSLSSLYKAKGSVRVAHRMVQPQTPVKPRAAVEGGKGGL
FT                   FDNSFVWMNLDFAGPSDEFIFNLVDGRLVSVEYPTTGSVLRRV"
     atgcttctta gcaaaacatt gcttggatcc atattgggat tcgctgttag ctcaacagcg        60
     cgaatcatcg ccacagatga agtccccttg ctcggtccat ccttcctctc caactttgat       120
     ccctctaatt caaccgcgat cagccacgcc aaatcggagt tccctggctt gatcgataac       180
     ctcttctcga ctggcgctct caatcgcaca gatttggcat ttcacattga cgtgttttcg       240
     gcttctacaa ataaatccat ctacagctac tcgcacgtcg gagaaaactc caaaaagtct       300
     gttacgtctg gagaactaaa tgacaagacc atctcacgcc tcggaagcgt gacaaagctc       360
     ttcactgtct acgcaatcat cgccaaggcc ggcatagaag tattcagcga cccggtgacc       420
     aagtacctcc ccgaactggc tggtaatcca gcctatgacc cattggagag catacgctgg       480
     gaggatatta cagttggagc gctagcatct cagcaagctg gctctggcgg tgctgctgat       540
     ttcctcaaac actacctgga ccccgagagg ccattacaat attcagccga agatcttttg       600
     aaattcttcc gcgacgagaa gaagccggta atttcaccat tccgaaatgc ggtctattcc       660
     gatggcggct ttgctatcct agggcaggta cttgcgcgcc tgtcggggaa gacttacagc       720
     gaagctgttc aagagattct cttcgatcca ctggaactgg agtccatgtc gacaaaagtg       780
     ccaacgggtc ctgatcttaa cgttatcgat cgccgcatca ttgacaagaa tacatcatgg       840
     ggtgttgacg tagaagttat tgcgtcaact ggcagttatt attccaacgc ggcagacctt       900
     cgcaccgcag gtcttgccat cttaaactcc gagctactct cccccgccac aacgtcacaa       960
     tggatgaaac ccagcagtgg aactggcagt ctggtagagc ttgtcggtgc cccatgggaa      1020
     atctctcgcc tagagatccc cgttacccca ggctcaaacc gcacccgtat ctcagatctt      1080
     tacaccaagg ccggcggaaa catcgactac acagccattt ttgccctgtc cccggaccac      1140
     ggcatcggct actccatcct ggtagccggt ttcactgcga cgcccgcccg ctggccccta      1200
     cgcgacgtgg ttggcgagac attcatcccc gcggccgagc acgccgctgc agagaatgcc      1260
     aagcgaaacc tggctggcac gttcgccgac cagacgtcac cggatacaaa cctgacgctg      1320
     tctgttgatc gaggccgccc ggggctgggg ctgaaatcgt tctgggttaa gggtaccaac      1380
     gcccgcgatc atgcgcattg gcgtctctac ccgaccggtc ttaactcgtt ctcgaagtcg      1440
     ttgtcttcct tgtacaaggc caagggtagt gttcgtgtgg cgcaccggat ggtgcagcca      1500
     cagaccccgg tgaagcctcg tgctgctgtg gaaggtggga agggaggatt gtttgataac      1560
     tcgtttgtgt ggatgaacct tgactttgcg gggccatccg acgagtttat tttcaacctg      1620
     gttgatggac gacttgtcag tgttgagtat ccgactaccg ggtccgtcct caggcgagtt      1680
     tga                                                                    1683
//

If you have problems or comments...

PBIL Back to PBIL home page