(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE515

PENCW_13.PE515       Location/Qualifiers
FT   CDS_pept        join(1215338..1215389,1215447..1216282)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20671914"
FT                   /orf_name="Pc16g05150"
FT                   /product="Pc16g05150 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP93185.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI0001831B2B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9C2"
FT                   /transl_table=1
FT                   /translation="MARVLEGKFGIVTGGSRGIGEAIARNLAEKGCSLLLNFTSESSRA
FT                   PTEALCSSLATTHNIKCESVQADLSKPAEAVTAIITAAKERFSTSGKFQIDILINNAGV
FT                   SQDRNLNDANKGPIEAEHFNWQYSINVLAPLLLTQACAPFLPTDRSGRIVSISSVSSSL
FT                   GFVGQSIYGGTKAAIEAMTRTWARELSDRATVNAVNPGPVVGDMYFATGEQFWKDIQGY
FT                   QDNTPLSKLDVNNEDTMSRLTDEQKRLIQEKMGGRRPAFTSEIAGVVGMLCTPDGLWCT
FT                   GSVVCANGGMKMGQ"
     atggctcgtg tacttgaagg gaaattcggc atcgtcactg gcggatcgcg gggaattggc        60
     gaagcaattg cccgtaacct tgccgaaaag ggctgctcac tgcttctgaa cttcacttca       120
     gagtcctcgc gcgcccccac cgaagcactg tgctcctcct tagccacaac ccataacatc       180
     aaatgcgaga gcgtgcaggc cgacctgagc aaacccgccg aagctgtgac ggcaatcatc       240
     actgccgcaa aagaacgttt cagcacatcc ggaaaattcc agatcgacat tttgatcaat       300
     aatgccggcg tatcccaaga ccgaaacctg aacgatgcca acaagggccc catcgaggcg       360
     gagcacttca actggcaata ctccatcaat gtcctcgccc cgcttctcct cacacaggca       420
     tgcgctccct tcctcccgac cgaccgaagc ggtcgcatcg tgagcatctc cagtgtatcc       480
     tcatcgctcg gtttcgtggg ccagtcgatc tacggcggta ccaaggctgc cattgaggcg       540
     atgactcgca cctgggcacg tgagctgtca gatcgtgcga ctgttaatgc cgttaacccc       600
     ggcccggttg ttggtgatat gtactttgcc accggggagc agttttggaa ggatatccaa       660
     ggataccagg ataacacgcc tctgagcaag ttggatgtca ataatgagga cactatgagc       720
     cgcttgactg atgagcagaa gcggttgatt caggagaaga tgggtggccg tcgaccggct       780
     ttcactagtg agattgcggg tgttgttggc atgttgtgta cacctgatgg tctttggtgt       840
     actggcagtg tggtatgtgc caatggtggc atgaagatgg gacaataa                    888
//

If you have problems or comments...

PBIL Back to PBIL home page