(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE516

PENCW_13.PE516       Location/Qualifiers
FT   CDS_pept        1216549..1217145
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179180" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948810"
FT                   /orf_name="Pc16g05160"
FT                   /product="Pc16g05160 protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAP93186.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0001831B2C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9C3"
FT                   /transl_table=1
FT                   /translation="MPGFSFPPDFTIPTPRLQISPFNPNNPAHCAFLVQLWNTDGFISS
FT                   CGKTGITTPEKAHSFLKGRVSEYYAYHGYGTFLVSRQTEDGVKPIGTVSLTRGIPPGPH
FT                   YLAPDIGFAMLPEECRKGHATEAAKALLEYAGKNLGVEAVFGFCSPANRWSRGALENIG
FT                   MEFRGVKPLKVFGGEDSAVYVLPGMSGDLSVYNLD"
     atgccaggat tctccttccc accggacttc acaattccca ctccacgtct ccaaatcagc        60
     cccttcaacc ccaacaaccc agcccactgc gctttcttag tccaactgtg gaatacagac       120
     ggtttcatca gctcgtgcgg gaaaacagga atcaccacac cggaaaaggc acattcgttc       180
     ctcaaaggca gagtctccga atactatgcc taccatggct acggcacgtt cctagtctca       240
     agacagactg aagatggcgt gaagccgatc ggcactgtat cgctcacgag gggcattcca       300
     ccaggaccac attatctcgc cccagatatt gggttcgcca tgttgcctga agaatgtagg       360
     aaggggcatg cgaccgaggc tgcaaaggct cttttggagt acgcaggtaa gaatcttggc       420
     gtagaggctg tgtttggatt ctgctcgcct gcgaatcgat ggagtcgggg cgctttggag       480
     aatattggga tggagtttag gggggtgaag cctttgaagg tttttggggg agaggatagc       540
     gctgtgtacg ttttgcctgg aatgagtggt gacttgagtg tttacaatct tgactga          597
//

If you have problems or comments...

PBIL Back to PBIL home page