(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE518

PENCW_13.PE518       Location/Qualifiers
FT   CDS_pept        1218791..1219894
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128966"
FT                   /orf_name="Pc16g05180"
FT                   /product="Pc16g05180 protein"
FT                   /protein_id="CAP93188.1"
FT                   /db_xref="UniParc:UPI0001831B2D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9H2"
FT                   /transl_table=1
FT                   /translation="MRYSMINGLLLLTVSPMSVLALPVDPNALPGQWNPSGQHPNNHWQ
FT                   NGQGGWTDANGQWHNNGAVGPRHWPDDHKNQDGWTDGSGKWHPNNPNNQNGQWHANQNG
FT                   QQYNNGWTDANGQWHNDGDVRPRDWPNDHHNNQNGWTDASGKWHANNPNNQNGQWHANN
FT                   QNGWTDASGKWHANNQNGWTDSNGQWHVDHKRDVIPGLNGAVNSNGANLLNGAVRHRRS
FT                   WRDGDNDQNNGNYGEGNNGNGIGNYGNNGNNGNDWNNGNNGNGNWKRGNGNGNGNGNGH
FT                   GNGNNGNNGNNGNNDWKRNDGFNRDIDSVANPSVIPRDSNSDIKSVANPSLVNSVTKPL
FT                   NSRDSNSDIDSVVNPSTIPHDQPTNNA"
     atgcgctact ctatgatcaa cggccttctt ctgttgacag tctcccctat gtctgtcctc        60
     gcgcttcccg tggaccccaa tgctctgcct ggtcaatgga acccgagtgg acagcaccca       120
     aataaccact ggcagaatgg tcagggcggt tggactgacg ccaacggtca atggcacaat       180
     aatggcgctg tcggccctcg tcactggcca gatgaccaca agaatcagga tggctggact       240
     gatggcagtg gcaaatggca ccccaacaac cccaacaacc aaaacggcca atggcacgcc       300
     aaccaaaacg gtcagcagta caacaatggc tggaccgacg ctaacggcca gtggcacaat       360
     gatggcgatg tccgcccccg tgactggccg aatgaccacc acaacaacca gaacggctgg       420
     accgatgcca gtggtaaatg gcacgccaac aacccgaaca accagaatgg ccaatggcat       480
     gccaacaacc agaatggctg gactgatgcc agtggtaaat ggcacgccaa caaccaaaat       540
     ggctggacag attccaacgg ccagtggcac gtggaccaca agcgtgatgt tattcccggc       600
     ctaaatggag ctgtcaacag caacggcgcc aaccttttga acggtgctgt tcgtcaccgc       660
     cgcagctggc gcgacggtga caatgaccag aacaatggca actacggtga aggtaacaat       720
     ggcaatggca ttgggaacta cggtaacaac ggcaacaacg gaaacgactg gaacaatggc       780
     aacaacggca atggtaactg gaaacgtggc aacgggaatg gcaatgggaa cggcaatgga       840
     catggcaatg gcaacaacgg caacaatggc aacaacggca acaacgactg gaagcgcaac       900
     gatggattca accgtgatat cgattcggtg gccaacccct ctgtgatccc ccgtgactcg       960
     aacagcgaca tcaagtcggt tgccaacccc tccttggtca actctgtgac caagcccctg      1020
     aactcccgtg attccaacag cgatatcgac tcggtggtca atccttccac aatcccccac      1080
     gaccagccca ccaacaacgc ctag                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page