(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE519

PENCW_13.PE519       Location/Qualifiers
FT   CDS_pept        join(1221277..1221658,1221718..1221910,1221960..1222059)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128967"
FT                   /orf_name="Pc16g05190"
FT                   /product="Putative uncharacterized protein Pc16g05190 "
FT                   /protein_id="CAP93189.1"
FT                   /db_xref="UniParc:UPI0001831B2E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9H3"
FT                   /transl_table=1
FT                   /translation="MHANVDSGKLLIGSLCGAEDPYVQYSAYFWGIIGICSHFKASTDL
FT                   FWKIPRYSTTMGGLNYGWPNLEIHSTFKAYKYTKTSLIRLVLQPIHLLQTFKNLIKLAN
FT                   MKVFTPIFVLIAFATSQAIAVPAAEAVDLETRADYCVDIKVCHGYNYEGGCYKECKRPG
FT                   KAYDIKKEYQKNAGSFKIGTKGYKCHIGSPDHGTLPVDYPGTKRLRNDFINNITGYQCN
FT                   KV"
     atgcatgcaa atgtggattc tggaaagttg cttattggta gtctatgtgg agctgaagac        60
     ccttacgttc aatactctgc atatttctgg ggcatcattg gcatatgtag ccactttaag       120
     gcgtccactg atctattttg gaaaataccc agatactcta ctactatggg tggcctaaac       180
     tatgggtggc ctaatcttga aatacatagc acattcaaag catataaata caccaaaaca       240
     tctctaatca gactggtatt gcaacccatt catcttctac aaacattcaa aaacctgatt       300
     aaactagcaa atatgaaagt cttcacacca atcttcgtgt taattgcatt cgctacctcc       360
     caggcaattg ctgtacctgc agctgaggct gtagacctgg agacgcgcgc cgactattgc       420
     gttgatatca aagtatgcca cggctataac tatgagggtg gctgctataa agaatgcaag       480
     aggcccggta aggcttacga tatcaaaaaa gaataccaga aaaacgctgg ctcgttcaaa       540
     attgggacca agggttacaa gtgccatatt ggatcacctg atcatggcac gctcccagtg       600
     gactaccctg ggaccaagag actcaggaat gatttcatca acaacattac aggatatcag       660
     tgcaacaaag tctaa                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page