(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE520

PENCW_13.PE520       Location/Qualifiers
FT   CDS_pept        join(complement(1223525..1223815),
FT                   complement(1223153..1223460),complement(1222269..1223079))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000201861" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977839"
FT                   /orf_name="Pc16g05200"
FT                   /product="Pc16g05200 protein"
FT                   /function="catalytic activity"
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP93190.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0001831BFF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9H4"
FT                   /transl_table=1
FT                   /translation="MLFSFGTALCALGTASALVISERGVETRDVSGTAHVYLKESNGPS
FT                   QHYASGYIYGIPDTPNQIPDHFYSDIAFQYTRAGGAQTPESKGWIGGQDDYTFRWESTL
FT                   SNYRTARQQGGQFILLVHDLWGADSLQSEDAPFPGDNDDWSFYDEFLSALISDIKDNDL
FT                   IDGVTIDIWNEPDGRNFWDREQDQYLLMWGRATARFKSELPNLALSGPSVSYPPTPDDE
FT                   WWNNWASYVVSNQSLPEEHHWHSLSKTFTSTEMLKNYDALLAKYSATREGLVNINEYGH
FT                   PDEQNPSGSAWWIAQLERANIFGCRANWASAYALHDFMAQLLGKPGAGTDDYDPKATGY
FT                   YPNGEYQVYKYYASSMVGDRIKTETTMDTNGDVYATVDAEGGVLRLLAGARTTTGTWSI
FT                   QLEELSALGLPKSGEVGIHTYEFPGSDDPYARLDEPVDLGTVTHKYSEDSLTFPIYSEN
FT                   VYDAWAFEIKF"
     atgcttttca gttttgggac agctctatgc gctctcggga cggcgtccgc gctcgttatc        60
     agcgagcgag gtgttgagac ccgagatgtt tcagggacag cgcatgtgta cctcaaggag       120
     tcgaatggcc cctctcagca ctatgcgtcg ggctatatat atggcatccc tgatacgccg       180
     aaccagatcc ctgatcactt ttactctgac atagcgttcc agtacaccag ggcaggaggt       240
     gctcagactc ctgagtcaaa gggttggatt gggggtcaag acgactacac gttccgatgg       300
     gagtcgaccc taagcaatta tcgcaccgct cgccagcagg gtgggcagtt tattctcctg       360
     gttcatgacc tctggggcgc cgatagcctg caatcagaag atgcgccatt ccctggtgac       420
     aatgacgact ggtccttcta tgacgagttc ctatccgccc tcatttctga cattaaggac       480
     aatgacctga ttgacggtgt cacgattgat atctggaacg agcctgatgg ccgcaacttc       540
     tgggaccgtg agcaggatca atacttgcta atgtggggac gcgccactgc caggttcaag       600
     tctgagcttc ctaatctcgc acttagcggc ccatcggtat cttacccccc gacgcctgat       660
     gatgagtggt ggaacaactg ggcctcctac gtcgtttcca accaatcact acctgaagag       720
     caccactggc acagcctcag caaaacattc acctcgactg agatgctgaa gaactacgac       780
     gccctcctcg caaagtacag cgcaactcgt gagggcctcg taaatatcaa cgaatacggc       840
     caccccgacg aacagaaccc ctcgggaagc gcctggtgga tagcacagct cgagcgcgcc       900
     aacatctttg gctgccgcgc caactgggca tcagcctatg ccttgcacga cttcatggcc       960
     cagctcttgg gtaagcccgg cgccggtacg gatgactacg atcctaaggc taccggctac      1020
     tacccaaacg gcgagtatca agtctacaag tactatgcat ctagcatggt tggtgaccgg      1080
     atcaaaactg agacaacgat ggataccaac ggcgatgtct acgccacggt cgatgccgaa      1140
     ggcggcgttc ttcgcctcct ggcgggtgct agaaccacca caggtacctg gtccattcaa      1200
     ctggaagagc tctctgccct tggtctgccc aagtcgggcg aggtcggaat ccacacgtat      1260
     gaatttcctg gctcggatga tccttatgct cgcttggatg agccagtcga cctaggcacc      1320
     gtgactcaca agtattctga ggatagtctt acgtttccga tatattcgga aaacgtatac      1380
     gatgcttggg catttgagat taaattctga                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page