(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE522

PENCW_13.PE522       Location/Qualifiers
FT   CDS_pept        complement(1226159..1228165)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212187" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948811"
FT                   /orf_name="Pc16g05220"
FT                   /product="Pc16g05220 protein"
FT                   /function="carbohydrate binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP93192.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0001831C00"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9H5"
FT                   /transl_table=1
FT                   /translation="MLQHSDGKLVYTFDAETLWIEPWGPNAVRIRSTRARQMPDQNWAL
FT                   LDPGSASSTLHEDPKGGSSLRNGNIQASISETGKIQVHNSKGELLLQEYTRNRKHVADP
FT                   KCSAIKVEGREFKPIPNSESYHLTARFESVDPDEMLFGMGQYQQPFLDLKGHELELAHR
FT                   NSQASVPFLVSSLGYGLLWNNPSIGKSFLGRNIMSFEARSTTTLDYWVVAGDTPADIVE
FT                   TYSAAVGKVPMMPEFGLGFWQCKLRYQTQEELLQVAREYKRRELPIDLIVIDFFHWPLQ
FT                   GDWRFDPTYWPDPTAMVQELKSMNIELMISVWPTVDKRSENYREMVEKGFLIRTDRGVR
FT                   TAMDFQGDTIHFDATHPGARAYIWEKCKANYYDHGIRSFWLDETEPEYKAYDFDNYRYY
FT                   EGPNTAIGNLYPVGYTQAFYEGMEQAGQKNIVNLVRCAWAGSQRYGALVWSGDIASSWD
FT                   SFRNQLSAGLHMGMSGIPWWTTDIGGFHGGDPTDSKFRELFVRWFQWGAFCPVMRLHGD
FT                   REPRQPIQGTTGGALCASGADNEVWSYGPAVYEICKKYMLLREALRDYIRELMKQAHVK
FT                   GSPVMRTLFYQFPEDPQCWKIGTQYMYGDKFLCCPVLQEGQRKVKAYLPVSSSDEKWFP
FT                   FHSDEVGHEGYEGGQWIEVDAPLHWMPVFVRDH"
     atgctccaac actcagacgg caaattagtt tacaccttcg atgccgagac gctatggatc        60
     gagccatggg gacctaatgc cgttcggatc agatcgactc gcgcccggca aatgcctgat       120
     cagaactggg ccctgctcga ccctggctcg gcttcctcta cactccatga ggatcccaag       180
     ggtgggagtt cgttgcggaa tggaaatatc caggcgagca tctcagagac cgggaaaatt       240
     caagtacata actccaaggg tgagctccta ttgcaggagt acactcgcaa ccggaaacat       300
     gttgcggatc ccaaatgcag cgcgatcaaa gtggaaggac gggagttcaa gcccattccc       360
     aacagtgaga gctaccacct cacagcccgc tttgagagtg tcgatccaga cgagatgctc       420
     tttggcatgg gacagtatca gcaacccttc ctcgacctca agggccatga actagagctt       480
     gcacatcgca actcccaggc cagcgtccct tttttagtgt cctcgttggg ctatggattg       540
     ctatggaata acccttctat cggaaaatcc ttcctcggac gaaacattat gtccttcgag       600
     gcccggtcga ccacaaccct cgactactgg gttgttgccg gagacacccc tgcggatatt       660
     gtggagacgt actcggccgc ggtcggcaag gtgcccatga tgccagagtt cggcttgggg       720
     ttctggcagt gcaaacttcg ttaccagacc caggaggaac ttctccaggt agctcgcgag       780
     tacaagcgcc gcgaactacc gatcgatctg atcgtgattg atttcttcca ctggccgctc       840
     cagggcgact ggcgatttga tcccacctac tggcccgatc cgacggccat ggtccaagag       900
     ctcaagagta tgaacatcga gctgatgatc agtgtctggc ccactgttga caagcggagc       960
     gagaactacc gggaaatggt agaaaagggg ttcctgattc gcacggatcg aggagtccgc      1020
     acggccatgg actttcaagg agacaccatc catttcgatg caacgcatcc gggcgcacgg      1080
     gcatacatct gggagaaatg caaggccaac tactatgatc atggcatccg ttctttctgg      1140
     ctagatgaaa ccgaacccga gtacaaggcc tatgactttg acaactaccg atattatgag      1200
     ggccccaata ccgcgatcgg aaacctctat cctgtaggat acactcaggc gttctacgag      1260
     ggaatggaac aggctgggca gaagaacatt gtcaacttgg tccggtgcgc gtgggcgggc      1320
     agccagaggt atggtgccct agtgtggagc ggagacattg cttcctcctg ggacagcttt      1380
     cggaatcaac tgtcagccgg tctgcacatg ggcatgagcg ggattccgtg gtggactacc      1440
     gatattggcg gcttccacgg aggcgacccc acggatagca aattcagaga gctctttgtc      1500
     cggtggttcc aatggggcgc attctgtcct gtgatgcgcc tacatggcga ccgggagccc      1560
     aggcagccca tccaaggcac gactggaggt gccctctgtg ctagcggcgc ggacaacgag      1620
     gtctggtcgt acggacccgc tgtgtatgag atctgcaaga agtatatgtt gttgagggaa      1680
     gccctacggg actatatccg cgagcttatg aaacaagcgc acgtcaaggg atctcccgtc      1740
     atgcgcacgc tcttttatca gtttccggaa gacccccaat gctggaagat tggcacccag      1800
     tacatgtacg gagacaaatt cctttgctgc ccggtgctcc aggagggcca gcgtaaagtc      1860
     aaggcgtatt taccggtgtc gagcagcgac gaaaagtggt ttccatttca tagtgatgag      1920
     gtgggacatg aaggatatga aggagggcag tggattgagg tcgacgcgcc tctacattgg      1980
     atgccagtat tcgtgagaga tcattga                                          2007
//

If you have problems or comments...

PBIL Back to PBIL home page