(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE523

PENCW_13.PE523       Location/Qualifiers
FT   CDS_pept        join(1228995..1230779,1230842..1230986,1231066..1231698,
FT                   1231795..1232108)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076680" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948812"
FT                   /orf_name="Pc16g05230"
FT                   /product="Pc16g05230 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP93193.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001831C01"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9H6"
FT                   /transl_table=1
FT                   /translation="MNSDHSPTHRGGLIQCDVCQATFTRQEHLNRHIRSHTTEKPFQCL
FT                   QCGKSFTRLDVLHRHNQSHVSKPLGDRSGKKFRACKECAVSRVRCSRGDPCERCSQREI
FT                   QCIYPVAEKRKTQSSLDRRHSSPRPTTSISSSAPGSPANSSQLEPSRPPVDSAGVSAPS
FT                   TAPHTLGLDPGMQPLNPLSSTSDSTNHWGWLPLQSSGTLPGASTEVINGNMPVFDSQIL
FT                   EKDLNEWVGNMASVNWLSPQGPDFFPDAQLDDLLLLGISAGVAGQGETVNGLENYGLEK
FT                   TNDAPPLLENSNVASVPALPHQFSGDQQTPVMEPVHSASGETTADTPVSRPPEGTYYVE
FT                   GSAGRAPFQGKSSWRASRYSPWGSNLGSTGRRTPVSERAESSCGLFVSEMVYKDCVRSF
FT                   AAEANRLEIGPDMASIPSLGEMQDLVQLYFVGFHPTYPFLLKHPSIFIPSSHWILLLAV
FT                   AATGSRYSSKARYHLLGESLIYVVDQILCNRLNNPVVGDGNQLWNPVPEVEEKRALDFV
FT                   TLQAALLNYLSLLHCGQNGAVQRALNRRYHLIEAYRSLNLLSVAGKPSSEIRGEADPED
FT                   VFRHWLDSESLIRTGWMIWLLDSITSYQFHCTPLVHLGEVKARLPCREDIWDISSSPEP
FT                   GCNLNCQSVTLLEALEMLYMEKKLPPNLGDLSSSVLIFAICRRNQEASAQHQTELTFWS
FT                   PNAEKQPRQIPRPTEETWPPAIPSLSKWRNSACDCFDILHWNANSIAARVGGWEHPTIL
FT                   HLHIARLMLLAPVQHIQKLAVYPLAPLTSPNSIPAAHMTARYHTLRWAIRDQYKARLCI
FT                   VHAGALLWHVRRYSSNSFLEPFGVYAATLIIWAYSISMQTMRKSEDSDCETEPTVIQLD
FT                   RPCDDEIVQAYVRFGHNMSARMHRVGDICEASAPRRILKQGIRLLTSDVTDPDGVRPGW
FT                   GVEKSYIDSLNTFITSPVVSQKNDHLSP"
     atgaattcgg atcactcgcc cacccaccga ggcggcctga tccagtgcga tgtgtgccag        60
     gcgactttca cccgacaaga acacctcaac cgtcacatcc gcagccatac cacagagaaa       120
     ccgttccagt gcttacagtg cggcaaatcc ttcacccgtc tagacgtcct ccaccgccac       180
     aatcagtcgc atgtgtccaa gcctttgggt gaccggagtg ggaagaaatt cagggcctgc       240
     aaggaatgcg ctgtgagtcg cgttcgttgc tcgcggggcg atccctgtga gcgctgttct       300
     cagagagaga tccaatgcat ttatcccgtg gcggaaaaga gaaagaccca gtcgtcctta       360
     gatcgcaggc actcgtctcc ccggccgacg accagcattt cctcctccgc ccccggatcc       420
     cccgccaact cctcccagct tgagccatcg cgaccccctg tggactcggc aggcgtctcg       480
     gctccctcca cagctccgca cactctggga ctagacccgg gaatgcagcc tttgaatccg       540
     ctgtcatcaa cgtcggactc cacgaaccac tggggatggc tgcctctgca aagctccggt       600
     acactcccag gcgcaagcac tgaggtaatc aacggaaata tgccagtgtt tgatagtcaa       660
     atactggaaa aggaccttaa cgaatgggtt gggaacatgg cctcggtgaa ctggctgtct       720
     cctcagggtc ccgacttttt cccagacgcc cagctagacg atttactgct actcgggatc       780
     agcgctgggg ttgctgggca gggtgaaacc gtgaacggac tcgaaaatta cggccttgag       840
     aaaaccaacg atgcacctcc gcttcttgaa aattccaatg tggcctcggt gccggccctc       900
     ccgcaccaat tttcgggcga tcaacagacg ccggtaatgg aacccgttca ctcggcatct       960
     ggagaaacta cggctgacac accagtgtcg cgacctcctg agggaacata ttacgtagaa      1020
     gggagcgctg gacgtgcacc atttcaaggc aaatcgagct ggagagctag cagatattcc      1080
     ccgtgggggt cgaatttggg ctctactggg agaagaaccc ccgtgtcgga gcgtgccgaa      1140
     agctcctgtg ggctctttgt gtcggaaatg gtgtacaagg attgtgttcg aagcttcgcg      1200
     gcggaggcta acagattaga gatcggcccg gatatggcca gtataccgtc actgggcgag      1260
     atgcaggacc tagtacagct ttactttgtt ggtttccacc caacctaccc cttcttgcta      1320
     aaacacccat ccatatttat ccccagctca cattggattc tgctcctggc agttgctgct      1380
     accggttcac ggtattctag caaggccaga tatcatctcc ttggagagtc tctaatatat      1440
     gtagtcgacc aaatattatg caaccgactc aataatcccg tggttggtga tggcaatcag      1500
     ctgtggaacc cagttccaga ggttgaagaa aagcgagcct tagatttcgt aacgcttcag      1560
     gctgcgttac tgaactattt atcacttctc cattgtggac aaaacggggc tgttcaacgt      1620
     gctctcaacc ggaggtacca tcttattgag gcctatcgct ctctgaatct cctttcggtc      1680
     gcagggaaac cctcgtcgga aattcggggc gaagcagacc cagaggacgt ctttcgacat      1740
     tggcttgact cagaatcgct catcaggacc ggttggatga tctggttgct cgattccatc      1800
     acttcgtacc aattccattg cactcctcta gtccacttgg gggaggtgaa ggcccgtctt      1860
     ccctgtcgag aggatatctg ggatatttct tcctctcctg aacctggttg taatttgaat      1920
     tgtcagtcag taacactact agaagcactt gaaatgctct atatggaaaa gaaattacct      1980
     cccaacttgg gtgacctcag ctctagcgtt ctgatttttg ccatatgtcg gcgcaaccaa      2040
     gaagccagcg cacagcacca aacggagctg accttctggt cgcctaacgc ggagaagcag      2100
     ccgcgacaaa tccctcgccc aacagaggag acatggccac cggcgatacc atccttgtcc      2160
     aaatggcgta acagtgcctg tgactgtttc gacatcctgc attggaatgc taatagcata      2220
     gcagcgcggg taggtgggtg ggaacacccg accatcctgc acctccacat cgcacgcctc      2280
     atgctcctgg ctccggtaca gcatatccag aagctcgcag tgtaccccct ggcacctctc      2340
     acttctccaa attcgatccc ggctgcccat atgacggctc gataccacac cttgcggtgg      2400
     gccattcgtg atcagtataa ggcgagactc tgtattgttc acgcaggtgc tttgctctgg      2460
     catgttcggc gatacagcag caatagcttt cttgaaccat tcggcgtata tgcggccact      2520
     cttataattt gggcgtatag catctcaatg caaaccatgc gaaaaagcga ggacagtgat      2580
     tgcgaaactg agccaacggt catccagctc gaccgtccct gcgatgatga aattgttcaa      2640
     gcgtatgttc gttttgggca caacatgtcc gcccgtatgc atcgggttgg agatatctgt      2700
     gaagccagcg ctccgcgacg gatcctcaag caggggatcc gattactaac gagcgatgtg      2760
     acagaccccg atggggtccg acctggttgg ggggtggaaa agtcctacat cgactccctg      2820
     aacaccttca tcactagtcc tgttgtctct caaaagaacg accatttgtc tccctga         2877
//

If you have problems or comments...

PBIL Back to PBIL home page