(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE527

PENCW_13.PE527       Location/Qualifiers
FT   CDS_pept        join(1240612..1240648,1240775..1241349,1241404..1241433)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948814"
FT                   /orf_name="Pc16g05270"
FT                   /product="Pc16g05270 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP93197.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001831C05"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9I0"
FT                   /transl_table=1
FT                   /translation="MSAAFVGEALPGACQTCRRRKTKCDSNYPCSTCVDGGESCVREPS
FT                   SRQAFTPVTRSSREGSHRKQKTPINAEELDPTSAWNLTMPSAEDTSPIQVSHMRLDWNP
FT                   PMNRSASNSIANTRSALRDVCAEDPLQPLIDPLVAVMSGINTTTSTPSENPLYYGRPSD
FT                   IMSFPFEAPFWQPSELRDYVGTDQSEVYMSNVPTYNPADFQQTQLPQYLG"
     atgagtgctg cgtttgtggg cgaagctttg ccaggagcat gccagacatg tcgccgccgt        60
     aagacaaagt gtgattccaa ctacccttgt tccacatgtg tcgacggcgg ggaatcatgt       120
     gtgcgtgaac cgtctagtag acaggcattc acccctgtca cacgatcatc ccgcgagggt       180
     tcccatagga agcaaaagac accgatcaat gcagaggaac tagatcccac cagcgcttgg       240
     aacctgacca tgccaagtgc ggaggatacc tccccaatac aagtatcgca catgcgactg       300
     gattggaacc ctccgatgaa tcgaagtgcg agtaacagca ttgccaatac ccgctctgcc       360
     ttgagagatg tgtgtgcaga agatcccctg caaccattaa tcgatccctt ggtggccgtg       420
     atgtccggga tcaatacaac cacatctaca ccgagcgaga accctttgta ctacggtcgt       480
     ccatctgaca tcatgagctt tccgtttgaa gcaccattct ggcaaccttc tgaactgagg       540
     gattacgttg gtacagacca atctgaagtg tacatgagca atgtgccaac ctataacccc       600
     gcggattttc aacaaacaca gctacctcaa tatttagggt aa                          642
//

If you have problems or comments...

PBIL Back to PBIL home page