(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE528

PENCW_13.PE528       Location/Qualifiers
FT   CDS_pept        join(1242415..1242578,1242640..1243657)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948815"
FT                   /orf_name="Pc16g05280"
FT                   /product="Putative uncharacterized protein Pc16g05280 "
FT                   /protein_id="CAP93198.1"
FT                   /db_xref="UniParc:UPI0001831C06"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9I1"
FT                   /transl_table=1
FT                   /translation="MRMRTLWWTSSLAYFVSFVNVGYGYSCVSQWCDTCLPAEVHDAPG
FT                   VGFDLTPSYGTAVVHYHNGTVVEVAKIPGSPEYLELMARLATTSKPSPNSTLDSISEIS
FT                   SQLMENLLPDVSSPWRDWWRWLNTKLGRPVKPDEVEIISDLLQQLKVSTERRISQPLDR
FT                   VAVTDPGFQSLESATLNAALRMLDLRTWVGDSIYYAHRIVEGDAVYAANGYGLCTDYLD
FT                   PSLCSDEFAESPDSTVLFVSYNRNLLYTSIVEGVTSEAFSRITRVEAQLVDYELGLDRL
FT                   LEKDEAALWDRLRSQLQILPREFEHPITHLLLAGESVTHPRFLATLRDSISELSPDVVN
FT                   IKLAIDPTFAAARGAALYARRRQEVQSNCTERSECEETRLHERLHTPTQVELH"
     atgagaatga gaactctgtg gtggacttct tctctggcat attttgtgtc ttttgtcaat        60
     gttgggtacg ggtacagctg tgtcagtcag tggtgtgata catgtcttcc tgcagaggtg       120
     cacgatgcac ctggggttgg ctttgatcta accccttcat acgggacagc cgtggtacac       180
     taccataatg gcactgttgt cgaggttgcc aagattccag gaagtccaga gtacctcgaa       240
     ctcatggcac gtctggctac tacatctaag ccgtctccca actcaaccct ggattccata       300
     agtgaaattt catcacaatt aatggaaaat ctccttcccg acgtgtcatc gccgtggaga       360
     gactggtggc gttggctgaa cacgaaactc ggtcgaccgg tcaaaccaga tgaggtcgaa       420
     atcatcagtg atttactcca gcaattgaaa gtctcaaccg aaagaaggat atcccagcct       480
     ctcgatagag ttgccgttac ggatcccggc ttccagtcgc tggaatcagc gacactcaac       540
     gctgcacttc gaatgttaga tttgcgcaca tgggtaggcg atagcattta ttatgcacat       600
     cggatagtgg aaggagatgc tgtttatgcg gcgaacggtt atggactatg caccgattac       660
     ttggatccgt ccctttgtag tgacgaattt gcagagtcac ctgattctac cgtgcttttt       720
     gtttcctata accgcaatct cttgtatact agcattgtgg aaggtgtcac cagtgaagcc       780
     tttagtcgga ttactcgtgt tgaggcgcag ctcgtagatt acgagcttgg gctagaccgt       840
     cttctcgaga aagacgaagc cgcattatgg gaccgccttc gttcacaact ccagatcctc       900
     ccacgggagt tcgaacaccc tattacgcat ctgcttttag caggcgagag cgtaacgcac       960
     cctcgcttcc tagctacctt gagggattct atatctgaac tctcgcctga tgttgtcaat      1020
     atcaaactcg caatagatcc aactttcgct gcggctcgtg gtgcggcact atacgcccga      1080
     aggcgccaag aggtgcagag caactgcacg gaacggagtg aatgcgaaga gacgaggttg      1140
     cacgagcgat tgcacactcc cacacaagtg gagctgcact ga                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page