(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE529

PENCW_13.PE529       Location/Qualifiers
FT   CDS_pept        join(complement(1246271..1246444),
FT                   complement(1245818..1246237))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076681" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948816"
FT                   /orf_name="Pc16g05290"
FT                   /product="Putative uncharacterized protein Pc16g05290 "
FT                   /protein_id="CAP93199.1"
FT                   /db_xref="UniParc:UPI0001831C07"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9I2"
FT                   /transl_table=1
FT                   /translation="MSDMEVQVAAQTRAALKADLTLRCVLRGKYRHKSRRSADVIPWAQ
FT                   SRVERLSNAVLRELNVIQMLRLRNVVYIFYDLFLDECDKQVRTEITESFHTKRPIHAIT
FT                   RKGKVYIMRRDERADKDVAQQYAQMSSIDKGPRPFFSDLADPPFYNEHGRRIERGEEGY
FT                   VPLAEMLREDDRRLQEEADEKRRQDEPDGNMEQD"
     atgtcggaca tggaggttca agttgctgcc cagactcgcg cggcattgaa ggcggacctc        60
     accttgcggt gtgtgctccg aggtaaatac cgccataagt cccgacgctc tgcggatgtc       120
     attccctggg cgcaatcacg cgttgagaga ctgagcaatg ccgtactccg agaattaaac       180
     gtgattcaaa tgcttcgtct tcgaaacgtt gtgtacattt tttacgatct cttccttgat       240
     gagtgcgaca aacaagttcg caccgagatt acggagagct ttcacacgaa gcggccaatc       300
     catgcgatta ctcgaaaggg gaaggtttat attatgcgaa gggatgaacg ggcggacaaa       360
     gatgtggctc aacagtacgc gcaaatgagt agcatcgaca aaggaccacg gcccttcttt       420
     tctgatttgg cggatccgcc tttttataat gagcatggtc ggcgtatcga gcggggggag       480
     gaggggtatg tgccgctagc ggagatgctt cgagaggacg acagacgcct ccaggaagaa       540
     gctgatgaga agagacgtca agatgagccg gatggtaaca tggagcaaga ttaa             594
//

If you have problems or comments...

PBIL Back to PBIL home page