(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE530

PENCW_13.PE530       Location/Qualifiers
FT   CDS_pept        join(complement(1247206..1247405),
FT                   complement(1247014..1247149))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824620"
FT                   /orf_name="Pc16g05300"
FT                   /product="Putative uncharacterized protein Pc16g05300 "
FT                   /protein_id="CAP93200.1"
FT                   /db_xref="UniParc:UPI0001831C08"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9I3"
FT                   /transl_table=1
FT                   /translation="MSHVHAAPVGGSPPPTEDIPHPGSVESLVAALGASGVRSLLWDVF
FT                   FFFCAVVAILRLDHFFKRVIDRGFPPPTPPPELPVRRRPPMTAEDHDRILAEYRVNRPP
FT                   ATPQGDE"
     atgtctcatg tacacgctgc gccggttggc gggtctcccc cgcccaccga ggacattccc        60
     catccggggt ctgttgagag cctggtggct gccctgggcg cgtccggagt ccgctcgctt       120
     ctctgggacg ttttcttttt cttttgcgcc gtggtggcca tattgcgcct ggaccacttc       180
     ttcaagcgcg tgatcgaccg tggcttccct ccaccaactc caccaccgga gctcccggtg       240
     cggcgtcggc cgccaatgac tgccgaggac cacgaccgga tacttgctga gtacagggtc       300
     aaccgtcctc ctgctacccc acaaggagat gagtag                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page