(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE531

PENCW_13.PE531       Location/Qualifiers
FT   CDS_pept        complement(1247864..1248694)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076657" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977841"
FT                   /orf_name="Pc16g05310"
FT                   /product="Pc16g05310 protein"
FT                   /protein_id="CAP93201.1"
FT                   /db_xref="UniParc:UPI0001831C09"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9I4"
FT                   /transl_table=1
FT                   /translation="MRPADELNQPKFVLTLPREKTQDEIEIERSGDIDALQRYRWNVVH
FT                   QNKYHYANRAVELLRVEQELRSTVQEEQILAEKPETTRIWSIYNDTQAKLQALDKRYWL
FT                   LERQWWKVRNSFVEGPLIRAFDLWRSHPLWYMHRALVEDCERRGGCCSRSCGCCVNREI
FT                   GKTRQLGAGHCMVACGCCHRARGFELTEKEKMGFLTDFHIVDDNSVYRQRINRVSIWGL
FT                   SLDSHVSPFDMIIMPRGCKKVLSKEQMTKGKVEQVEEASALIDDEEKKEAASGY"
     atgcgacctg cggacgagct gaatcaacca aaatttgtct taaccctgcc tcgagagaag        60
     acacaagacg agatcgagat cgaacggagt ggagatatcg atgctcttca acggtatcgg       120
     tggaatgtgg tccatcaaaa taagtatcac tacgctaatc gagcggttga gctactccgg       180
     gtagaacaag agcttcgaag tactgtccag gaagagcaaa tcctcgccga gaagcccgag       240
     accacgcgta tctggtcaat ctacaatgat acacaggcta agcttcaggc gttggataag       300
     agatattggt tgctggaacg acagtggtgg aaagtccgga actcattcgt agagggaccg       360
     ctaatacgag cctttgacct atggcgatca catcctctat ggtatatgca ccgagcttta       420
     gttgaggatt gcgagagaag aggagggtgc tgtagccgta gctgtggatg ttgcgttaat       480
     cgtgagattg gcaagacacg acagcttgga gccggacatt gtatggtggc atgtggatgt       540
     tgtcaccgag ctcgggggtt cgagcttacc gaaaaagaaa agatgggatt ccttacggat       600
     ttccatatcg tggacgacaa tagtgtttac cgccaaagga tcaatcgagt ttcaatatgg       660
     gggttatctc tggatagtca tgtcagccct tttgatatga ttataatgcc ccgaggatgc       720
     aagaaggttc tttcaaaaga gcagatgaca aaaggcaagg ttgaacaagt cgaggaagca       780
     tctgctctta ttgacgatga ggagaagaaa gaagctgcgt caggctacta g                831
//

If you have problems or comments...

PBIL Back to PBIL home page