(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE532

PENCW_13.PE532       Location/Qualifiers
FT   CDS_pept        1249463..1250245
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217883" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824621"
FT                   /orf_name="Pc16g05320"
FT                   /product="Pc16g05320 protein"
FT                   /protein_id="CAP93202.1"
FT                   /db_xref="InterPro:IPR021369"
FT                   /db_xref="UniParc:UPI0001831C0A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9I5"
FT                   /transl_table=1
FT                   /translation="MGSQDSLLSTIRHQNHTWEDGKQTENNRLLELRRKVQDFVYTPFG
FT                   CLITVYVLNVIAWGGMDFLLICNFVPAMCHPTCEDPHSPRLEWIEIDSQILVALLCVPA
FT                   FALAPLRYRDLYHLLRYRLCRNRGCLRKLAGYNKDWFRVYGDFEAKLDLEDAGVTREIT
FT                   EDYCSGPVAAAPLHLSTSPWKLDFVVWCKALNTAFQATLAGFMWGYKRLDRPPWSSTIS
FT                   MLFAFSCIAMAKITVFLEDRRVRDLEAPETILLWTIQR"
     atgggtagcc aggactctct actttcgaca atcaggcatc agaaccacac ttgggaagat        60
     gggaagcaaa ctgagaataa tagactcttg gaattgcgtc ggaaggtaca agactttgta       120
     tatacaccgt tcggttgcct tatcaccgta tacgtcctca acgtgattgc ttggggtggt       180
     atggactttc tcttgatctg caactttgta ccagcaatgt gccatcccac ctgcgaagat       240
     cctcattctc ctcgccttga atggatcgag attgacagcc agatccttgt ggccctgctg       300
     tgcgttcctg catttgcgct tgcaccatta cgatatcgag atctgtatca cttgttaagg       360
     tatcgtctgt gtcgcaatcg aggctgccta cgcaaacttg caggatacaa taaggactgg       420
     ttcagggtat atggggattt tgaggctaaa ctcgaccttg aagacgccgg agtcacaagg       480
     gaaattacag aagattactg ctctggtccg gtagctgcgg ctcccctgca tttgtcgacg       540
     agtccatgga aacttgattt tgtggtctgg tgcaaggcac tgaacaccgc atttcaagcc       600
     accttggctg ggtttatgtg gggatacaaa cgattggacc gtcctccctg gtcgtcgacg       660
     atctctatgc tatttgcctt cagttgcatt gccatggcca aaattacagt gttcttggaa       720
     gatagacgag ttcgagattt ggaggcaccg gaaaccatac tgctctggac tatccaaagg       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page